Clone Name | rbastl26e09 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | ODP1_BUCAI (P57301) Pyruvate dehydrogenase E1 component (EC 1.2.... | 30 | 1.2 | 2 | CEMA_CHLRE (Q37050) Chloroplast envelope membrane protein | 30 | 2.0 | 3 | PDC2_CANAL (O60035) Protein PDC2 | 28 | 6.0 | 4 | SGCG_HUMAN (Q13326) Gamma-sarcoglycan (Gamma-SG) (35 kDa dystrop... | 28 | 7.8 |
---|
>ODP1_BUCAI (P57301) Pyruvate dehydrogenase E1 component (EC 1.2.4.1)| Length = 887 Score = 30.4 bits (67), Expect = 1.2 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +2 Query: 71 LGTLDKRKNIAAQMKHVYTGGPIHVRKNYGVLVGKKE 181 +G + + KNIA Q+K + G IH+R + + V E Sbjct: 397 MGVIAEGKNIAHQIKKININGIIHIRDRFNIPVSNDE 433
>CEMA_CHLRE (Q37050) Chloroplast envelope membrane protein| Length = 500 Score = 29.6 bits (65), Expect = 2.0 Identities = 14/30 (46%), Positives = 20/30 (66%) Frame = +1 Query: 187 HSISQVLLFSCWQLNLYTLLYVLVA*EIQV 276 HSI + F L+L+TLLY+L+ EIQ+ Sbjct: 373 HSIEAITNFFADLLSLFTLLYLLITLEIQI 402
>PDC2_CANAL (O60035) Protein PDC2| Length = 836 Score = 28.1 bits (61), Expect = 6.0 Identities = 12/32 (37%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = +1 Query: 154 LRCVGWKKRTMHSISQVLLFSCW-QLNLYTLL 246 +R + W R+ HS+S +FS W + +L+ LL Sbjct: 428 IRAIEWITRSWHSVSSERIFSSWKKTHLFNLL 459
>SGCG_HUMAN (Q13326) Gamma-sarcoglycan (Gamma-SG) (35 kDa dystrophin-associated| glycoprotein) (35DAG) Length = 290 Score = 27.7 bits (60), Expect = 7.8 Identities = 15/57 (26%), Positives = 30/57 (52%), Gaps = 1/57 (1%) Frame = +1 Query: 88 KKEYCCSNEA-CLHRGPNSCTEKLRCVGWKKRTMHSISQVLLFSCWQLNLYTLLYVL 255 +++Y + E C+ R N K+ GW+KR ++ + +LL +NL +++L Sbjct: 2 REQYTTATEGICIERPENQYVYKIGIYGWRKRCLY-LFVLLLLIILVVNLALTIWIL 57 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 41,360,450 Number of Sequences: 219361 Number of extensions: 815241 Number of successful extensions: 2470 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2426 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2470 length of database: 80,573,946 effective HSP length: 73 effective length of database: 64,560,593 effective search space used: 1549454232 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)