Clone Name | rbastl26e03 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | APRR9_ARATH (Q8L500) Two-component response regulator-like APRR9... | 30 | 2.7 |
---|
>APRR9_ARATH (Q8L500) Two-component response regulator-like APRR9| (Pseudo-response regulator 9) Length = 468 Score = 30.0 bits (66), Expect = 2.7 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -2 Query: 399 PTRKKNSANLYRHMWASMSRRSPPAKMATSAP 304 P RK NL++H+W ++ R P A S P Sbjct: 142 PMRKNELKNLWQHVWRRLTLRDDPTAHAQSLP 173 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 60,743,773 Number of Sequences: 219361 Number of extensions: 1125154 Number of successful extensions: 3047 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 3009 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3044 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2618960580 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)