Clone Name | rbastl26d06 |
---|---|
Clone Library Name | barley_pub |
>NCCH_ALCXX (Q44583) RNA polymerase sigma factor nccH| Length = 186 Score = 29.6 bits (65), Expect = 3.0 Identities = 13/46 (28%), Positives = 26/46 (56%) Frame = +1 Query: 247 IIQRSTIGSWDTYQALNRAGEMKLPWMFIIKLSRLKDLMELRGIGH 384 I+Q + I +W + + ++ PW+F I L++++DL R + H Sbjct: 50 IVQDTFIAAWHALDDFD-SDKLFRPWLFRIGLNKMRDLRRFRQVRH 94
>RUMA_DECAR (Q47HS4) 23S rRNA (uracil-5-)-methyltransferase rumA (EC 2.1.1.-)| (23S rRNA(M-5-U1939)-methyltransferase) Length = 432 Score = 29.3 bits (64), Expect = 3.9 Identities = 12/24 (50%), Positives = 17/24 (70%) Frame = +3 Query: 342 LKAEGPDGATRHWPSGGPTGTYEM 413 L+ +GPD A R +PSGGP +Y + Sbjct: 224 LQPKGPDTAFRFYPSGGPRLSYTL 247
>ISP4_SCHPO (P40900) Sexual differentiation process protein isp4| Length = 785 Score = 28.9 bits (63), Expect = 5.1 Identities = 22/92 (23%), Positives = 45/92 (48%) Frame = +3 Query: 45 YKS*RILTISTSKAQ*FDLGYSYIDSKTYKLIIQMNMDVKLNKDSVSTGVDVITSMQKAL 224 Y++ + +ST+ A F L ++ I S + +I+ ++ ++ D+ + KA Sbjct: 400 YQNYSPIFMSTTYALAFGLSFASITSVIFHVILYHGKEI-YDRLRDPPAPDIHEKLMKAY 458 Query: 225 NGVFWYIYYSTVHNRIMGYLPGSK*SWRNETP 320 + V +Y +Y +V G + G+ W+ ETP Sbjct: 459 DEVPFY-WYLSVFLAFFGMMMGTIYGWKTETP 489
>YKE7_YEAST (P36090) Hypothetical 58.9 kDa protein in ELM1-PRI2 intergenic| region Length = 516 Score = 28.9 bits (63), Expect = 5.1 Identities = 21/86 (24%), Positives = 34/86 (39%), Gaps = 2/86 (2%) Frame = +3 Query: 75 TSKAQ*FDLGYSYIDSKTYKLIIQMNMDVKLNKDSVSTGV--DVITSMQKALNGVFWYIY 248 T+K +D G +Y ++ +I N + S GV DV + + + IY Sbjct: 92 TAKTTTYDYGIAYFKQNSFDIIENDNRIDRSKVQMFSLGVIIDVQNASSDSKKHFYKEIY 151 Query: 249 YSTVHNRIMGYLPGSK*SWRNETPLD 326 ++ NR YL W + LD Sbjct: 152 HAYAANRYSSYLESLLGQWIRQRDLD 177
>FMT_SYNPX (Q7U6Z1) Methionyl-tRNA formyltransferase (EC 2.1.2.9)| Length = 338 Score = 28.5 bits (62), Expect = 6.7 Identities = 16/56 (28%), Positives = 25/56 (44%), Gaps = 8/56 (14%) Frame = +3 Query: 258 VHNRIMGYLPGSK*SW--------RNETPLDVHHQTLKAEGPDGATRHWPSGGPTG 401 +H ++MG PG++ SW + E +D L E + WP+GG G Sbjct: 230 IHRQVMGLYPGAQTSWNGKRLKLTQTEPLIDRLKDQLSPEAQE-LVGQWPTGGHAG 284
>BRL1_ARATH (Q9ZWC8) Serine/threonine-protein kinase BRI1-like 1 precursor (EC| 2.7.11.1) (BRASSINOSTEROID INSENSITIVE 1-like protein 1) Length = 1166 Score = 28.1 bits (61), Expect = 8.8 Identities = 15/35 (42%), Positives = 18/35 (51%) Frame = +3 Query: 261 HNRIMGYLPGSK*SWRNETPLDVHHQTLKAEGPDG 365 HN + GYLPGS S + LDV + L P G Sbjct: 696 HNNLQGYLPGSLGSLSFLSDLDVSNNNLTGPIPFG 730 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 62,712,985 Number of Sequences: 219361 Number of extensions: 1238288 Number of successful extensions: 2477 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2403 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2477 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2278320915 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)