| Clone Name | rbastl26d03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | INX4_DROME (Q9VRX6) Innexin inx4 (Innexin-4) (Protein zero popul... | 29 | 4.5 | 2 | CLV1_ARATH (Q9SYQ8) Receptor protein kinase CLAVATA1 precursor (... | 29 | 4.5 |
|---|
>INX4_DROME (Q9VRX6) Innexin inx4 (Innexin-4) (Protein zero population growth)| Length = 367 Score = 29.3 bits (64), Expect = 4.5 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 124 HLCTDIHKLRKCQIPSRTYL 183 HLC D HK+ C+ SRT+L Sbjct: 141 HLCDDFHKMAVCKDKSRTHL 160
>CLV1_ARATH (Q9SYQ8) Receptor protein kinase CLAVATA1 precursor (EC 2.7.11.1)| Length = 980 Score = 29.3 bits (64), Expect = 4.5 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -2 Query: 327 SQMLSVLNIALSCVTFSPDARPKMRNVLRLLAN 229 + ++ V IA+ CV ARP MR V+ +L N Sbjct: 937 TSVIHVFKIAMMCVEEEAAARPTMREVVHMLTN 969 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 58,168,431 Number of Sequences: 219361 Number of extensions: 1063276 Number of successful extensions: 2443 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2384 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2443 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2628831825 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)