Clone Name | rbastl26d02 |
---|---|
Clone Library Name | barley_pub |
>NADD_STRR6 (P65505) Probable nicotinate-nucleotide adenylyltransferase (EC| 2.7.7.18) (Deamido-NAD(+) pyrophosphorylase) (Deamido-NAD(+) diphosphorylase) (Nicotinate mononucleotide adenylyltransferase) (NaMN adenylyltransferase) Length = 209 Score = 29.6 bits (65), Expect = 2.3 Identities = 16/34 (47%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = +2 Query: 11 TKELATPKLKITTMPEVCQKKKKQ-RRAGGNITP 109 T EL TP K+ PE+ +KK+KQ GGN P Sbjct: 2 TIELLTPFTKVELEPEIKEKKRKQVGILGGNFNP 35
>NADD_STRPN (P65504) Probable nicotinate-nucleotide adenylyltransferase (EC| 2.7.7.18) (Deamido-NAD(+) pyrophosphorylase) (Deamido-NAD(+) diphosphorylase) (Nicotinate mononucleotide adenylyltransferase) (NaMN adenylyltransferase) Length = 209 Score = 29.6 bits (65), Expect = 2.3 Identities = 16/34 (47%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = +2 Query: 11 TKELATPKLKITTMPEVCQKKKKQ-RRAGGNITP 109 T EL TP K+ PE+ +KK+KQ GGN P Sbjct: 2 TIELLTPFTKVELEPEIKEKKRKQVGILGGNFNP 35
>KLDC4_HUMAN (Q8TBB5) Kelch domain-containing protein 4| Length = 520 Score = 29.6 bits (65), Expect = 2.3 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = +3 Query: 75 KNNGGPEGTSHHRLHYWAKQGIFF 146 K+ GGP G S HR+ W +Q I F Sbjct: 169 KSTGGPSGRSGHRMVAWKRQLILF 192
>FTSW_SYNY3 (P74180) Probable cell division protein ftsW| Length = 393 Score = 28.9 bits (63), Expect = 3.9 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = -1 Query: 87 LRCFFFFWQTSGIVVIFSLGVASSFVSS 4 +R FF W G+VV+FS A S +S Sbjct: 29 MRTLFFAWMAMGVVVLFSASYAESLDTS 56
>KLDC4_MOUSE (Q921I2) Kelch domain-containing protein 4| Length = 584 Score = 28.5 bits (62), Expect = 5.2 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +3 Query: 75 KNNGGPEGTSHHRLHYWAKQGIFF 146 ++ GGP G S HR+ W +Q I F Sbjct: 169 RSTGGPSGRSGHRMVAWKRQLILF 192
>NUDT7_ARATH (Q9SU14) Nudix hydrolase 7 (EC 3.6.1.-) (AtNUDT7) (ADP-ribose| pyrophosphatase) (EC 3.6.1.13) (NADH pyrophosphatase) (EC 3.6.1.22) Length = 282 Score = 28.1 bits (61), Expect = 6.7 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +2 Query: 50 MPEVCQKKKKQRRAGGNITPSTSLLGKTRDFFC 148 M +CQKK ++ G I P+T+ GK +C Sbjct: 231 MANICQKKCEEEYLGFAIVPTTTSSGKESFIYC 263 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30,220,564 Number of Sequences: 219361 Number of extensions: 530113 Number of successful extensions: 1565 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1559 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1565 length of database: 80,573,946 effective HSP length: 35 effective length of database: 72,896,311 effective search space used: 1749511464 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)