Clone Name | rbastl26c01 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | OVO_DROME (P51521) Protein ovo (Protein shaven baby) | 29 | 3.0 | 2 | TRUD_HALSA (Q9HSG5) Probable tRNA pseudouridine synthase D (EC 5... | 28 | 4.0 | 3 | MTSS1_HUMAN (O43312) Metastasis suppressor protein 1 (Missing in... | 28 | 6.8 |
---|
>OVO_DROME (P51521) Protein ovo (Protein shaven baby)| Length = 1351 Score = 28.9 bits (63), Expect = 3.0 Identities = 17/46 (36%), Positives = 22/46 (47%) Frame = +3 Query: 267 REQQAP*IHPSIHHYGRQGGPTTAEPSPKAQEAAASCRAWTGAAAS 404 ++Q P H S HH + PSP A AAA+ A AAA+ Sbjct: 972 QQQPQPQSHHSHHHGHGHDNSNMSLPSPTAAAAAAAAAAAAAAAAA 1017
>TRUD_HALSA (Q9HSG5) Probable tRNA pseudouridine synthase D (EC 5.4.99.-)| (tRNA-uridine isomerase D) (tRNA pseudouridylate synthase D) Length = 434 Score = 28.5 bits (62), Expect = 4.0 Identities = 15/29 (51%), Positives = 17/29 (58%), Gaps = 2/29 (6%) Frame = +3 Query: 321 GGPTTAEP--SPKAQEAAASCRAWTGAAA 401 G PT EP S +A+E A R WTGA A Sbjct: 207 GAPTEHEPADSQRAREYVAETRDWTGALA 235
>MTSS1_HUMAN (O43312) Metastasis suppressor protein 1 (Missing in metastasis| protein) (Metastasis suppressor YGL-1) Length = 755 Score = 27.7 bits (60), Expect = 6.8 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = +3 Query: 321 GGPTTAEPSPKAQEAAASCRAWTGAAASQ 407 GGPTTA P A E A R+ T +AA++ Sbjct: 440 GGPTTASGPPAAAEEAQRPRSMTVSAATR 468 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,972,225 Number of Sequences: 219361 Number of extensions: 597278 Number of successful extensions: 1328 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1296 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1328 length of database: 80,573,946 effective HSP length: 112 effective length of database: 56,005,514 effective search space used: 1344132336 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)