Clone Name | rbastl26b11 |
---|---|
Clone Library Name | barley_pub |
>THYG_RAT (P06882) Thyroglobulin precursor| Length = 2768 Score = 29.6 bits (65), Expect = 1.9 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = +3 Query: 177 RTPTPPQIKLLCHYVDVTIP 236 RTPTPPQI C Y++V +P Sbjct: 2271 RTPTPPQISEDCLYLNVFVP 2290
>THYG_MOUSE (O08710) Thyroglobulin precursor| Length = 2766 Score = 29.6 bits (65), Expect = 1.9 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = +3 Query: 177 RTPTPPQIKLLCHYVDVTIP 236 RTPTPPQI C Y++V +P Sbjct: 2269 RTPTPPQINEDCLYLNVFVP 2288
>HRG_HUMAN (P04196) Histidine-rich glycoprotein precursor| (Histidine-proline-rich glycoprotein) (HPRG) Length = 525 Score = 29.3 bits (64), Expect = 2.4 Identities = 17/67 (25%), Positives = 25/67 (37%), Gaps = 7/67 (10%) Frame = +2 Query: 116 HQKNLSSPHSRCYYFYCTHSTNPHPTTNKITLPLCGRDNPYG-------PKNNHPRGSKL 274 H N S H ++ + H HP + R +P+G P +HP G Sbjct: 342 HNNNSSDLHPHKHHSHEQHPHGHHPHAHHPHEHDTHRQHPHGHHPHGHHPHGHHPHGHHP 401 Query: 275 QGENSHC 295 G + HC Sbjct: 402 HGHHPHC 408
>DLLA_BRARE (Q6DI48) Delta-like protein A precursor (DeltaA protein)| Length = 772 Score = 28.1 bits (61), Expect = 5.4 Identities = 15/46 (32%), Positives = 22/46 (47%) Frame = +2 Query: 113 YHQKNLSSPHSRCYYFYCTHSTNPHPTTNKITLPLCGRDNPYGPKN 250 Y +N SSP SRC + C + H N+ +C + YG +N Sbjct: 475 YTGRNCSSPVSRCQHNPCHNGATCHERNNRY---VCACVSGYGGRN 517
>RIM15_YEAST (P43565) Serine/threonine-protein kinase RIM15 (EC 2.7.11.1)| Length = 1770 Score = 27.7 bits (60), Expect = 7.0 Identities = 16/52 (30%), Positives = 23/52 (44%), Gaps = 2/52 (3%) Frame = +2 Query: 101 INQQYHQKNLSSPHSRCYYFYCTHSTNPHPTTNKITLP--LCGRDNPYGPKN 250 + QQY SS + +HS P P+TN + P G+D +G N Sbjct: 1005 LGQQYEHSEYSSTSN-------SHSMTPTPSTNTVVYPSYYRGKDRSHGSSN 1049
>WSB1_HUMAN (Q9Y6I7) WD repeat and SOCS box-containing protein 1 (WSB-1) (SOCS| box-containing WD protein SWiP-1) Length = 421 Score = 27.7 bits (60), Expect = 7.0 Identities = 18/61 (29%), Positives = 25/61 (40%) Frame = +2 Query: 80 AMQGFYLINQQYHQKNLSSPHSRCYYFYCTHSTNPHPTTNKITLPLCGRDNPYGPKNNHP 259 A G Y Q H+ P S+C + H T ++ + LP R N G + N P Sbjct: 43 APDGSYFAWSQGHRTVKLVPWSQCLQNFLLHGTKNVTNSSSLRLP---RQNSDGGQKNKP 99 Query: 260 R 262 R Sbjct: 100 R 100
>BRS1_ARATH (Q9M099) Serine carboxypeptidase 2 precursor (EC 3.4.16.6) (Serine| carboxypeptidase II) (Carboxypeptidase D) (Bri1 suppressor 1) [Contains: Serine carboxypeptidase 2 chain A (Serine carboxypeptidase II chain A); Serine carboxypeptidase 2 chain Length = 465 Score = 27.7 bits (60), Expect = 7.0 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +2 Query: 125 NLSSPHSRCYYFYCTHSTNPHPTTNKITLPLCG 223 N++ H R +++ T S++P P T + L L G Sbjct: 52 NVNQSHGRALFYWLTESSSPSPHTKPLLLWLNG 84
>HUNB_DROMU (O46250) Protein hunchback (Fragments)| Length = 174 Score = 27.7 bits (60), Expect = 7.0 Identities = 16/50 (32%), Positives = 21/50 (42%) Frame = +2 Query: 95 YLINQQYHQKNLSSPHSRCYYFYCTHSTNPHPTTNKITLPLCGRDNPYGP 244 YL QQ HQ++ H + C + P P+ N P G NP P Sbjct: 55 YLKQQQQHQQHQQHQHQQPMDRCCAAAMTPSPSNNDQNSP--GLPNPMQP 102 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 46,630,223 Number of Sequences: 219361 Number of extensions: 771371 Number of successful extensions: 1604 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1590 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1604 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 1402043640 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)