Clone Name | rbastl26a10 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | EXOC6_ARATH (Q9LXX6) Probable exocyst complex component 6 (Exocy... | 33 | 0.22 | 2 | SRE13_CAEEL (O45300) Serpentine receptor class epsilon-13 (Prote... | 30 | 1.4 |
---|
>EXOC6_ARATH (Q9LXX6) Probable exocyst complex component 6 (Exocyst complex| component Sec15) Length = 789 Score = 32.7 bits (73), Expect = 0.22 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = -2 Query: 362 RDTSESYFSTFGTRGARQNPKKKSLDTLIKRLKE 261 +D+++ F + R + KKKS+D L KRLKE Sbjct: 754 KDSADGIFGSLANRNTKLTAKKKSMDMLKKRLKE 787
>SRE13_CAEEL (O45300) Serpentine receptor class epsilon-13 (Protein sre-13)| Length = 359 Score = 30.0 bits (66), Expect = 1.4 Identities = 12/30 (40%), Positives = 20/30 (66%), Gaps = 3/30 (10%) Frame = -1 Query: 171 LLHTTIFLKVECLLHMCGYLNSIL---FYY 91 ++H TIF+ + CL ++ YLN +L +YY Sbjct: 177 VIHVTIFILLSCLAYLSNYLNFLLNRSYYY 206 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 50,242,919 Number of Sequences: 219361 Number of extensions: 909474 Number of successful extensions: 1712 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1700 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1712 length of database: 80,573,946 effective HSP length: 96 effective length of database: 59,515,290 effective search space used: 1428366960 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)