| Clone Name | rbastl25h10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Y917_PYRAB (Q9V074) UPF0130 protein PYRAB09170 | 30 | 1.5 | 2 | PEVR2_PAPHA (Q863Y8) Porcine endogenous retrovirus A receptor 2 ... | 30 | 1.5 | 3 | PEVR2_HUMAN (Q9NWF4) Porcine endogenous retrovirus A receptor 2 ... | 28 | 4.5 | 4 | YB00_YEAST (P38114) Probable transcriptional regulatory protein ... | 28 | 4.5 | 5 | DPH4_GIBZE (Q4I7G0) Diphthamide biosynthesis protein 4 | 28 | 5.9 |
|---|
>Y917_PYRAB (Q9V074) UPF0130 protein PYRAB09170| Length = 194 Score = 30.0 bits (66), Expect = 1.5 Identities = 16/52 (30%), Positives = 28/52 (53%) Frame = -1 Query: 161 LHISTRCLKNSSKNVLLGINCSCDYCKDSRVRITSDYKIAVKCEQRLMMNAL 6 LH+ R L++ K + LG++C Y S ++ SD K+ V+ ++AL Sbjct: 104 LHVGARTLEDGIKLLNLGVSCGFKY---SNIKSISDRKLIVEIRSTERLDAL 152
>PEVR2_PAPHA (Q863Y8) Porcine endogenous retrovirus A receptor 2 precursor| (PERV-A receptor 2) (Protein GPR172B) Length = 448 Score = 30.0 bits (66), Expect = 1.5 Identities = 15/32 (46%), Positives = 20/32 (62%) Frame = -2 Query: 118 FYWALTAVVTIVKIAEFGLQVIIKSL*SVNNG 23 FYWALTA++ A GL +++ SL SV G Sbjct: 196 FYWALTALLVTSAAAFQGLLLLLPSLPSVTTG 227
>PEVR2_HUMAN (Q9NWF4) Porcine endogenous retrovirus A receptor 2 precursor| (PERV-A receptor 2) (Protein GPR172B) Length = 448 Score = 28.5 bits (62), Expect = 4.5 Identities = 14/32 (43%), Positives = 20/32 (62%) Frame = -2 Query: 118 FYWALTAVVTIVKIAEFGLQVIIKSL*SVNNG 23 F+WALTA++ A GL +++ SL SV G Sbjct: 196 FFWALTALLVTSAAAFRGLLLLLPSLPSVTTG 227
>YB00_YEAST (P38114) Probable transcriptional regulatory protein YBR150C| Length = 1094 Score = 28.5 bits (62), Expect = 4.5 Identities = 16/66 (24%), Positives = 27/66 (40%) Frame = -1 Query: 209 SPFSFFHLIFAELIRALHISTRCLKNSSKNVLLGINCSCDYCKDSRVRITSDYKIAVKCE 30 SPF L L + L + ++ + +CDYC+ ++R T I+ KC Sbjct: 69 SPFPDHRLRHHPLAHMMPADKNFLAYNMESFKSRVTKACDYCRKRKIRCTEIEPISGKCR 128 Query: 29 QRLMMN 12 + N Sbjct: 129 NCIKYN 134
>DPH4_GIBZE (Q4I7G0) Diphthamide biosynthesis protein 4| Length = 188 Score = 28.1 bits (61), Expect = 5.9 Identities = 12/37 (32%), Positives = 22/37 (59%), Gaps = 2/37 (5%) Frame = +3 Query: 3 LQSVHHQPLFTLHSDFIITCNPNSAIFTI--VTTAVN 107 ++ +H+ L H D + +P+S FT+ +TTA+N Sbjct: 37 IKRAYHRALLRNHPDKVANSDPSSVFFTVDQITTALN 73 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,067,090 Number of Sequences: 219361 Number of extensions: 596223 Number of successful extensions: 1440 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1430 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1440 length of database: 80,573,946 effective HSP length: 77 effective length of database: 63,683,149 effective search space used: 1528395576 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)