Clone Name | rbastl25h04 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | G109A_HUMAN (Q8TDS4) Nicotinic acid receptor 1 (G-protein couple... | 31 | 0.91 | 2 | SPHS_SYNP7 (P39664) Sensor protein sphS (EC 2.7.13.3) | 30 | 2.0 | 3 | Y1R1_DROME (P16424) Hypothetical 50 kDa protein in type I retrot... | 29 | 2.6 |
---|
>G109A_HUMAN (Q8TDS4) Nicotinic acid receptor 1 (G-protein coupled receptor| 109A) (G-protein coupled receptor HM74A) Length = 363 Score = 30.8 bits (68), Expect = 0.91 Identities = 21/64 (32%), Positives = 32/64 (50%), Gaps = 10/64 (15%) Frame = -1 Query: 229 PTEDGGSSLSCGFVCCP-----EIFKRCSFSLPLVLILLCSIPVV----QYELE-HVSIK 80 P ++GG++L F C E F LPL +IL CS ++ Q +++ H IK Sbjct: 168 PIQNGGANLCSSFSICHTFQWHEAMFLLEFFLPLGIILFCSARIIWSLRQRQMDRHAKIK 227 Query: 79 RVIS 68 R I+ Sbjct: 228 RAIT 231
>SPHS_SYNP7 (P39664) Sensor protein sphS (EC 2.7.13.3)| Length = 413 Score = 29.6 bits (65), Expect = 2.0 Identities = 12/47 (25%), Positives = 24/47 (51%) Frame = -3 Query: 302 NMWLESATHLF*SPKRTQRTLSGKAHRRRRKQPKLWICMLSGDFQKM 162 N W+ H +P + R L+ R + +P++W+ L G+ Q++ Sbjct: 171 NRWVSDVAHELKTPLTSIRLLAEALRDRLQDEPQVWVDRLLGETQRL 217
>Y1R1_DROME (P16424) Hypothetical 50 kDa protein in type I retrotransposable| element R1DM (ORF 1) Length = 471 Score = 29.3 bits (64), Expect = 2.6 Identities = 17/48 (35%), Positives = 23/48 (47%) Frame = +3 Query: 84 METCSSSYCTTGMEQSKISTSGREKEHLLKISGQHTNPQLRLLPPSSV 227 ME+ SS +G SK+S GR + HL S T +L L + V Sbjct: 23 MESDSSVSALSGSSASKVSRRGRRRSHLASKSSAPTQAKLVALASNGV 70 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,581,417 Number of Sequences: 219361 Number of extensions: 837129 Number of successful extensions: 2097 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2062 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2096 length of database: 80,573,946 effective HSP length: 76 effective length of database: 63,902,510 effective search space used: 1533660240 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)