Clone Name | rbastl25h03 |
---|---|
Clone Library Name | barley_pub |
>ADAM7_MOUSE (O35227) ADAM 7 precursor (A disintegrin and metalloproteinase| domain 7) Length = 788 Score = 29.6 bits (65), Expect = 1.8 Identities = 10/23 (43%), Positives = 18/23 (78%) Frame = +3 Query: 120 NYRLCFRIHKQG*DFGVCKHRNN 188 ++ LC+R++K+G FG CK++ N Sbjct: 521 SHSLCYRMNKKGNRFGYCKNKGN 543
>MURB_SALPA (Q5PK78) UDP-N-acetylenolpyruvoylglucosamine reductase (EC| 1.1.1.158) (UDP-N-acetylmuramate dehydrogenase) Length = 342 Score = 29.3 bits (64), Expect = 2.4 Identities = 12/28 (42%), Positives = 17/28 (60%), Gaps = 1/28 (3%) Frame = -3 Query: 147 CVCENITCS*LHTGRHFKLTFV-CRFAY 67 CVC+ + C L TG+ +L+ CRF Y Sbjct: 131 CVCDYVDCVELETGKRLRLSAAECRFGY 158
>ATRX_CAEEL (Q9U7E0) Transcriptional regulator ATRX homolog (EC 3.6.1.-)| (ATP-dependent helicase xnp-1) (X-linked nuclear protein 1) Length = 1359 Score = 28.9 bits (63), Expect = 3.1 Identities = 12/24 (50%), Positives = 18/24 (75%) Frame = -1 Query: 377 SEQEDDDQDKSVDAKKKQSRHRAK 306 SE++DDD+++S K+SR RAK Sbjct: 64 SEEDDDDEEESPRKSSKKSRKRAK 87
>CA037_RAT (Q68FS7) Protein C1orf37 homolog| Length = 376 Score = 28.9 bits (63), Expect = 3.1 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -1 Query: 383 KLSEQEDDDQDKSVDAKKKQSRHRAKVTG 297 ++ QE+ Q++SV KKK RH+ + G Sbjct: 99 EMDAQEESTQERSVSRKKKSKRHKEDLDG 127
>YGDH_SCHPO (O94574) Putative 2-hydroxyacid dehydrogenase C1773.17c (EC| 1.-.-.-) Length = 340 Score = 28.5 bits (62), Expect = 4.1 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = +1 Query: 100 VPPSMELTTGYVFAYTNRARILVFANIETIINTGLPKNP 216 + P + T + A T V A+IET ++TG+P NP Sbjct: 295 IQPHCGVYTNFTVAKTEEC---VLASIETFLDTGIPTNP 330
>ADAM7_RAT (Q63180) ADAM 7 precursor (A disintegrin and metalloproteinase| domain 7) (Epididymal apical protein I) (EAP I) Length = 789 Score = 28.5 bits (62), Expect = 4.1 Identities = 9/23 (39%), Positives = 19/23 (82%) Frame = +3 Query: 120 NYRLCFRIHKQG*DFGVCKHRNN 188 ++ LC+R++++G FG CK+++N Sbjct: 521 SHSLCYRMNQKGNRFGYCKNKDN 543
>CA037_MOUSE (Q9JJB9) Protein C1orf37 homolog| Length = 375 Score = 27.7 bits (60), Expect = 7.0 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -1 Query: 383 KLSEQEDDDQDKSVDAKKKQSRHRAKVTG 297 ++ QE+ Q++SV KKK RH+ G Sbjct: 99 EMDAQEESTQERSVSRKKKSKRHKEDPDG 127 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,817,457 Number of Sequences: 219361 Number of extensions: 996071 Number of successful extensions: 1982 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1891 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1972 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 1391514312 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)