Clone Name | rbastl25g09 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | ARR2_ARATH (Q9ZWJ9) Two-component response regulator ARR2 (Recei... | 30 | 2.4 | 2 | LAX3_ARATH (Q9CA25) Auxin transporter-like protein 3 (AUX1-like ... | 30 | 3.2 | 3 | SYG_TREPA (O83678) Glycyl-tRNA synthetase (EC 6.1.1.14) (Glycine... | 29 | 5.4 |
---|
>ARR2_ARATH (Q9ZWJ9) Two-component response regulator ARR2 (Receiver-like| protein 5) Length = 664 Score = 30.4 bits (67), Expect = 2.4 Identities = 26/84 (30%), Positives = 40/84 (47%), Gaps = 1/84 (1%) Frame = +1 Query: 85 HISFNSFQ*VGYNSNLPTSSTPIASPKGILGRNFDILPVA-SYRSGFTCQDESYF*NNKI 261 H FN+F ++LP SS P+AS GI +PV+ SY+ D + Sbjct: 453 HSVFNNFP-----ADLPRSSFPLASAPGI------SVPVSVSYQEEVNSSDAKGGSSAAT 501 Query: 262 GDTGNPNLQLFNEHTPIVPQNRQN 333 GNP+ +FN+ PQ++Q+ Sbjct: 502 AGFGNPSYDIFND----FPQHQQH 521
>LAX3_ARATH (Q9CA25) Auxin transporter-like protein 3 (AUX1-like protein 3)| Length = 470 Score = 30.0 bits (66), Expect = 3.2 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = -3 Query: 80 TSTKLGNLFWGGGNMYFSSFKEYSN 6 T TKL N FW GG++Y + F SN Sbjct: 32 TKTKLSNFFWHGGSVYDAWFSCASN 56
>SYG_TREPA (O83678) Glycyl-tRNA synthetase (EC 6.1.1.14) (Glycine--tRNA| ligase) (GlyRS) Length = 462 Score = 29.3 bits (64), Expect = 5.4 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -2 Query: 180 PSEDAFWARYWCGRGW 133 P+ED W YWC + W Sbjct: 201 PAEDTHWFEYWCAQRW 216 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 72,505,562 Number of Sequences: 219361 Number of extensions: 1485765 Number of successful extensions: 2812 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2779 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2812 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3130907202 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)