Clone Name | rbastl25f03 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | MSX2_CANFA (Q9GK08) Homeobox protein MSX-2 (Hox-8) | 29 | 5.2 | 2 | TR10D_HUMAN (Q9UBN6) Tumor necrosis factor receptor superfamily ... | 29 | 5.2 | 3 | MSX2_HUMAN (P35548) Homeobox protein MSX-2 (Hox-8) | 28 | 8.8 |
---|
>MSX2_CANFA (Q9GK08) Homeobox protein MSX-2 (Hox-8)| Length = 267 Score = 28.9 bits (63), Expect = 5.2 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = +1 Query: 232 SVSRYSSDRRTAKRCAPMAADTAETTSALQPTLAISNGS 348 SV SD++ K +P AD+A +AL+P L +G+ Sbjct: 48 SVEALMSDKKPPKGASPRPADSASAGAALRPLLLPGHGA 86
>TR10D_HUMAN (Q9UBN6) Tumor necrosis factor receptor superfamily member 10D| precursor (Decoy receptor 2) (DcR2) (TNF-related apoptosis-inducing ligand receptor 4) (TRAIL receptor 4) (TRAIL-R4) (TRAIL receptor with a truncated death domain) (CD264 antigen) Length = 386 Score = 28.9 bits (63), Expect = 5.2 Identities = 21/49 (42%), Positives = 23/49 (46%), Gaps = 4/49 (8%) Frame = +1 Query: 193 LRANCGGGGAGVHSVSRYSSDRRTAKRCAPMAADTA--ETTS--ALQPT 327 L+ C GGG G V R RR+ P A D A ET S LQPT Sbjct: 240 LKGICSGGGGGPERVHRVLFRRRSCPSRVPGAEDNARNETLSNRYLQPT 288
>MSX2_HUMAN (P35548) Homeobox protein MSX-2 (Hox-8)| Length = 267 Score = 28.1 bits (61), Expect = 8.8 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = +1 Query: 232 SVSRYSSDRRTAKRCAPMAADTAETTSALQPTLAISNGS 348 SV SD++ K +P+ A++A + L+P L +G+ Sbjct: 48 SVEALMSDKKPPKEASPLPAESASAGATLRPLLLSGHGA 86 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,572,534 Number of Sequences: 219361 Number of extensions: 786875 Number of successful extensions: 2339 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2228 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2337 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2286875994 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)