| Clone Name | rbastl25d12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | L_NDVB (P11205) Large structural protein (Protein L) (Transcript... | 31 | 0.85 | 2 | YD57_SCHPO (Q10310) Hypothetical protein C6C3.07 in chromosome I | 29 | 3.2 | 3 | SMG1_DROME (Q70PP2) Serine/threonine-protein kinase Smg1 (EC 2.7... | 28 | 5.5 | 4 | GLTS_SYNY3 (P55038) Ferredoxin-dependent glutamate synthase 2 (E... | 28 | 5.5 |
|---|
>L_NDVB (P11205) Large structural protein (Protein L) (Transcriptase)| (Replicase) [Includes: RNA-directed RNA polymerase (EC 2.7.7.48); mRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.56); mRNA guanylyltransferase (EC 2.7.7.-)] Length = 2204 Score = 30.8 bits (68), Expect = 0.85 Identities = 12/35 (34%), Positives = 23/35 (65%) Frame = -3 Query: 285 CNSPLIPHHHGLEDDL*KQAVITFLTNSEMSHPRI 181 C++PL+ H +++ ++A+ FL N E+ HPR+ Sbjct: 1003 CSNPLLSGVHTEDNEAEEKALAEFLLNQEVIHPRV 1037
>YD57_SCHPO (Q10310) Hypothetical protein C6C3.07 in chromosome I| Length = 515 Score = 28.9 bits (63), Expect = 3.2 Identities = 11/41 (26%), Positives = 25/41 (60%) Frame = +1 Query: 169 TKQENSWVRHLRISQECDYSLLLQVVFKTMMVRNQRRVTTL 291 +KQEN +V+H++ S E L + +K + + ++++ +L Sbjct: 70 SKQENIYVKHIKSSNEAKTELEIFNCYKEISISKEKKINSL 110
>SMG1_DROME (Q70PP2) Serine/threonine-protein kinase Smg1 (EC 2.7.11.1)| Length = 3218 Score = 28.1 bits (61), Expect = 5.5 Identities = 15/50 (30%), Positives = 27/50 (54%), Gaps = 2/50 (4%) Frame = +1 Query: 127 RQMKLRYTDKHVRTTKQENSWVRHLRISQ--ECDYSLLLQVVFKTMMVRN 270 R+++ R T V Q N ++ +R+ E Y LLL+ +T+++RN Sbjct: 464 RRLRARLTPSLVHFIFQSNPYMTKVRLRSPGETSYKLLLRTCQETLLIRN 513
>GLTS_SYNY3 (P55038) Ferredoxin-dependent glutamate synthase 2 (EC 1.4.7.1)| (FD-GOGAT) Length = 1556 Score = 28.1 bits (61), Expect = 5.5 Identities = 13/62 (20%), Positives = 29/62 (46%) Frame = -3 Query: 324 ILRFVQTDEPVKGCNSPLIPHHHGLEDDL*KQAVITFLTNSEMSHPRIFLFGSSDMFVSV 145 ++R++ D+ NSP +PH HGL++ + I + + +L + + + Sbjct: 944 VVRYLTLDDVDSEGNSPTLPHLHGLQNGDTANSAIKQIASGRFGVTPEYLMSGKQLEIKM 1003 Query: 144 SQ 139 +Q Sbjct: 1004 AQ 1005 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,428,628 Number of Sequences: 219361 Number of extensions: 862746 Number of successful extensions: 1736 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1712 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1736 length of database: 80,573,946 effective HSP length: 96 effective length of database: 59,515,290 effective search space used: 1428366960 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)