ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbastl25d10 |
|---|---|
| Clone Library Name | barley_pub |
>SND1_MOUSE (Q78PY7) Staphylococcal nuclease domain-containing protein 1 (p100| co-activator) (100 kDa coactivator) Length = 910 Score = 30.8 bits (68), Expect = 0.82 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = -1 Query: 365 QEKAKKERLRLWQYGDVESD 306 QE AK RL LW+YGD +D Sbjct: 882 QESAKSARLNLWRYGDFRAD 901
>SND1_HUMAN (Q7KZF4) Staphylococcal nuclease domain-containing protein 1 (p100| co-activator) (100 kDa coactivator) (EBNA2 coactivator p100) Length = 910 Score = 30.8 bits (68), Expect = 0.82 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = -1 Query: 365 QEKAKKERLRLWQYGDVESD 306 QE AK RL LW+YGD +D Sbjct: 882 QESAKSARLNLWRYGDFRAD 901
>SND1_BOVIN (Q863B3) Staphylococcal nuclease domain-containing protein 1 (p100| co-activator) (100 kDa coactivator) Length = 910 Score = 30.8 bits (68), Expect = 0.82 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = -1 Query: 365 QEKAKKERLRLWQYGDVESD 306 QE AK RL LW+YGD +D Sbjct: 882 QESAKSARLNLWRYGDFRAD 901
>SND1_RAT (Q66X93) Staphylococcal nuclease domain-containing protein 1 (p100| co-activator) (100 kDa coactivator) (SND p102) (p105 coactivator) Length = 909 Score = 30.8 bits (68), Expect = 0.82 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = -1 Query: 365 QEKAKKERLRLWQYGDVESD 306 QE AK RL LW+YGD +D Sbjct: 881 QESAKSARLNLWRYGDFRAD 900
>NADB2_RALSO (Q8XQG4) L-aspartate oxidase 2 (EC 1.4.3.16) (LASPO 2) (Quinolinate| synthetase B 2) Length = 536 Score = 28.9 bits (63), Expect = 3.1 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = +2 Query: 245 CLLSSTDAGGVSSRLELALPRRIQ 316 C S TD G +SRL L LP RI+ Sbjct: 396 CAQSVTDTAGSASRLRLTLPERIE 419
>Y1356_MYCBO (P64806) Hypothetical protein Mb1356| Length = 98 Score = 28.1 bits (61), Expect = 5.3 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -3 Query: 279 ETPPASVDERRQWHAQSW 226 + P A VD+RR WH W Sbjct: 68 DLPQAGVDDRRHWHTPCW 85
>Y1322_MYCTU (P64805) Hypothetical protein Rv1322/MT1363.1| Length = 98 Score = 28.1 bits (61), Expect = 5.3 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -3 Query: 279 ETPPASVDERRQWHAQSW 226 + P A VD+RR WH W Sbjct: 68 DLPQAGVDDRRHWHTPCW 85
>DYN1_MOUSE (P39053) Dynamin-1 (EC 3.6.5.5)| Length = 867 Score = 28.1 bits (61), Expect = 5.3 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = -2 Query: 337 ACGSMETLNPTRKSKLQAGGDPPRVGRREKA 245 AC + E ++ + S L+AG P RVG +EKA Sbjct: 606 ACETQEEVDSWKASFLRAGVYPERVGDKEKA 636
>GHRL_ONCMY (Q76IQ4) Ghrelin precursor [Contains: Ghrelin-23; Ghrelin-24]| Length = 111 Score = 28.1 bits (61), Expect = 5.3 Identities = 15/33 (45%), Positives = 23/33 (69%), Gaps = 1/33 (3%) Frame = -2 Query: 346 KGCACGSMETLNPTRKSKLQAG-GDPPRVGRRE 251 K + GS L+P++K +++ G G PPRVGRR+ Sbjct: 22 KSVSAGS-SFLSPSQKPQVRQGKGKPPRVGRRD 53
>URED_SYNY3 (P73047) Urease accessory protein ureD| Length = 270 Score = 28.1 bits (61), Expect = 5.3 Identities = 12/41 (29%), Positives = 21/41 (51%) Frame = -3 Query: 267 ASVDERRQWHAQSWFRYESFGHRAKLSRELI*KLSKKERLY 145 ++V+ W A W RY+ GHR ++ L+ K +R + Sbjct: 5 STVNPSAPWQANLWLRYDRPGHRTRMVECLVQAPLKVQRSF 45
>DYN1_RAT (P21575) Dynamin-1 (EC 3.6.5.5) (D100) (Dynamin, brain) (B-dynamin)| Length = 851 Score = 28.1 bits (61), Expect = 5.3 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = -2 Query: 337 ACGSMETLNPTRKSKLQAGGDPPRVGRREKA 245 AC + E ++ + S L+AG P RVG +EKA Sbjct: 606 ACETQEEVDSWKASFLRAGVYPERVGDKEKA 636
>DYN1_HUMAN (Q05193) Dynamin-1 (EC 3.6.5.5)| Length = 864 Score = 28.1 bits (61), Expect = 5.3 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = -2 Query: 337 ACGSMETLNPTRKSKLQAGGDPPRVGRREKA 245 AC + E ++ + S L+AG P RVG +EKA Sbjct: 606 ACETQEEVDSWKASFLRAGVYPERVGDKEKA 636
>KIF17_MOUSE (Q99PW8) Kinesin-like protein KIF17 (MmKIF17)| Length = 1038 Score = 27.3 bits (59), Expect = 9.1 Identities = 14/45 (31%), Positives = 22/45 (48%) Frame = -2 Query: 157 RETIFMPLEEENYIHCFSPKLNKVCVLCGLRFLFVEAEHIIPRIA 23 +E PLE E Y+ P L + +L L+ F E E + R++ Sbjct: 585 QEAAASPLEAERYVQENEPSLEPLRILASLQDPFAEVEAKLARLS 629
>N4BM_HUMAN (O95298) NADH-ubiquinone oxidoreductase subunit B14.5b (EC 1.6.5.3)| (EC 1.6.99.3) (Complex I-B14.5b) (CI-B14.5b) Length = 119 Score = 27.3 bits (59), Expect = 9.1 Identities = 9/17 (52%), Positives = 15/17 (88%) Frame = -1 Query: 167 LVRKRDYIYAIRRRELY 117 LV++ DY+YA+R RE++ Sbjct: 74 LVKREDYLYAVRDREMF 90 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,540,782 Number of Sequences: 219361 Number of extensions: 843072 Number of successful extensions: 2289 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 2237 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2289 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 1386249648 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
