Clone Name | rbastl25d09 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | ATG15_DEBHA (Q6BLM0) Putative lipase ATG15 (EC 3.1.1.3) (Autopha... | 28 | 6.6 | 2 | NPY6R_MOUSE (Q61212) Neuropeptide Y receptor type 6 (NPY6-R) (Pa... | 28 | 8.6 |
---|
>ATG15_DEBHA (Q6BLM0) Putative lipase ATG15 (EC 3.1.1.3) (Autophagy-related| protein 15) Length = 615 Score = 28.5 bits (62), Expect = 6.6 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +1 Query: 43 RQQVEKHSPKLAELSRCQRSSAKSSNLFQVFTAF 144 ++ +E HS +L EL+ Q S SNL V+ A+ Sbjct: 102 KEYLEAHSEELEELTTMQTSEVDESNLQDVYDAY 135
>NPY6R_MOUSE (Q61212) Neuropeptide Y receptor type 6 (NPY6-R) (Pancreatic| polypeptide receptor 2) (PP2) Length = 371 Score = 28.1 bits (61), Expect = 8.6 Identities = 11/39 (28%), Positives = 22/39 (56%), Gaps = 5/39 (12%) Frame = +1 Query: 313 SAMVLHLIP*QVQSYLVLQDPRGWRPGV-----GLVPVW 414 S + L+ ++ Y ++ +PRGW+P V G++ +W Sbjct: 121 SVSIFSLVLIAIERYQLIVNPRGWKPRVAHAYWGIILIW 159 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,840,068 Number of Sequences: 219361 Number of extensions: 711124 Number of successful extensions: 2097 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1997 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2095 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2228238148 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)