Clone Name | rbastl25d07 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | SCRL2_ORYSA (Q5QNA6) SCAR-like protein 2 | 30 | 1.4 | 2 | RRN3_SCHPO (Q10110) RNA polymerase I specific transcription init... | 28 | 4.1 | 3 | SEZ6L_HUMAN (Q9BYH1) Seizure 6-like protein precursor | 28 | 4.1 | 4 | Y1418_HAEIN (P44189) Hypothetical protein HI1418 | 28 | 6.9 |
---|
>SCRL2_ORYSA (Q5QNA6) SCAR-like protein 2| Length = 1334 Score = 30.0 bits (66), Expect = 1.4 Identities = 15/34 (44%), Positives = 21/34 (61%) Frame = -1 Query: 385 QRALESLAKKSKHVVTPSSDVEKDHESDSDADVR 284 QRAL ++ S+H TPS+D E+ S +DVR Sbjct: 235 QRALTAVQLTSRHFATPSTDGRSLSENRSTSDVR 268
>RRN3_SCHPO (Q10110) RNA polymerase I specific transcription initiation factor| rrn3 Length = 599 Score = 28.5 bits (62), Expect = 4.1 Identities = 17/59 (28%), Positives = 29/59 (49%), Gaps = 6/59 (10%) Frame = +3 Query: 84 VSYEHTSITYRYVLEK*KRVNA------LQEVPQPSDWQLSLIYIVSRVFSRSSTLPSL 242 + YEH + +YVLE R ++ L+E P + L+ + +S V S +PS+ Sbjct: 171 IHYEHAHMALKYVLELVPRAHSFLYSSILEEFPYKDESLLAQMTYISNVLSICEYVPSI 229
>SEZ6L_HUMAN (Q9BYH1) Seizure 6-like protein precursor| Length = 1024 Score = 28.5 bits (62), Expect = 4.1 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = -3 Query: 221 SGEDP*NYIDQRKLPITRLGNFLQCIY 141 S +P YID P+ L NFL+C Y Sbjct: 284 SFSNPEGYIDSSDYPLLPLNNFLECTY 310
>Y1418_HAEIN (P44189) Hypothetical protein HI1418| Length = 201 Score = 27.7 bits (60), Expect = 6.9 Identities = 14/52 (26%), Positives = 24/52 (46%) Frame = +1 Query: 217 PEAQPFQVYFYQILLSQPMKLSS*HQHPSQIHGPSQHLKTE*QHALISLQEI 372 PEA+PF+ + ++ +L Q K P Q+ P K + LQ++ Sbjct: 101 PEAEPFEAWVFEEVLPQIRKTGKYQLQPQQLALPEPEKKFSFEFTEYELQQL 152 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,511,015 Number of Sequences: 219361 Number of extensions: 955391 Number of successful extensions: 3266 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2000 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3230 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 1380984984 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)