Clone Name | rbastl25d06 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | EXOC4_ARATH (Q93YU5) Probable exocyst complex component 4 (Exocy... | 37 | 0.027 | 2 | Y13L_BPT4 (P39505) Hypothetical 9.4 kDa protein in nrdB-nrdA int... | 33 | 0.40 | 3 | AT12A_RABIT (Q9TV52) Potassium-transporting ATPase alpha chain 2... | 30 | 2.6 | 4 | WNT4_DROME (P40589) Protein Wnt-4 precursor (dWnt-4) | 28 | 9.7 | 5 | O10Z1_HUMAN (Q8NGY1) Olfactory receptor 10Z1 | 28 | 9.7 | 6 | COL_PIG (P02703) Colipase precursor (Procolipase II) | 28 | 9.7 |
---|
>EXOC4_ARATH (Q93YU5) Probable exocyst complex component 4 (Exocyst complex| component Sec8) Length = 1053 Score = 37.0 bits (84), Expect = 0.027 Identities = 15/25 (60%), Positives = 20/25 (80%) Frame = -1 Query: 483 ILKVNVPGREIPMDAERRISQILGH 409 +LKVNVPGR+ P DA+ R+ +IL H Sbjct: 1029 LLKVNVPGRDTPSDAQSRLLEILSH 1053
>Y13L_BPT4 (P39505) Hypothetical 9.4 kDa protein in nrdB-nrdA intergenic| region Length = 83 Score = 33.1 bits (74), Expect = 0.40 Identities = 16/58 (27%), Positives = 30/58 (51%) Frame = +1 Query: 172 LHPKYHTFTRIKNKRSIQNTTNLLSMRQQIVHYLPICRHQKKKPNRNNKINYSYKESR 345 L+P Y T + ++ + T +L+S+R + P C H KK N+ N + + Y + + Sbjct: 21 LNPMYGTISPTRDVPHTKETRDLISLRTKQGAEYPPCPHCGKKVNKGNALRWHYDKCK 78
>AT12A_RABIT (Q9TV52) Potassium-transporting ATPase alpha chain 2 (EC 3.6.3.10)| (Proton pump) (Non-gastric H(+)/K(+) ATPase alpha subunit) (HK alpha 2) Length = 1094 Score = 30.4 bits (67), Expect = 2.6 Identities = 16/65 (24%), Positives = 31/65 (47%), Gaps = 4/65 (6%) Frame = +3 Query: 27 WLTFGIKFVAKVGTSVVTIYMRYVAATI*ITCGC----NNLNNKTHESDFVKITPKVSHI 194 W+ FGI++V+ S+ +Y+ V A + I G + + F K+ P+ + + Sbjct: 182 WIAFGIQYVSNPSASLDRVYLGTVLAVVVILTGIFAYYQEAKSTNIMASFCKMIPQQAVV 241 Query: 195 YKDQE 209 +D E Sbjct: 242 IRDSE 246
>WNT4_DROME (P40589) Protein Wnt-4 precursor (dWnt-4)| Length = 539 Score = 28.5 bits (62), Expect = 9.7 Identities = 16/56 (28%), Positives = 25/56 (44%) Frame = +1 Query: 190 TFTRIKNKRSIQNTTNLLSMRQQIVHYLPICRHQKKKPNRNNKINYSYKESRGRYC 357 T R K +I+ N SMRQ + + ++KKP ++ Y E+ YC Sbjct: 423 TLLRQKYNEAIRKAPNQRSMRQVSSSRMKKPKQRRKKPQQSQYTTLYYLETSPSYC 478
>O10Z1_HUMAN (Q8NGY1) Olfactory receptor 10Z1| Length = 313 Score = 28.5 bits (62), Expect = 9.7 Identities = 16/56 (28%), Positives = 30/56 (53%), Gaps = 4/56 (7%) Frame = -2 Query: 212 LFLILVNV*YFGCNFNKIRLVCFVIQIVAAT----CYSNCCSHITHVNCHNRCANF 57 L L+++ V +F + ++ +++I +A +S C SH+T V H CA+F Sbjct: 202 LSLLVLLVSFFFITISYAYILAAILRIPSAEGQKKAFSTCASHLTVVIIHYGCASF 257
>COL_PIG (P02703) Colipase precursor (Procolipase II)| Length = 112 Score = 28.5 bits (62), Expect = 9.7 Identities = 15/32 (46%), Positives = 20/32 (62%) Frame = -2 Query: 128 AATCYSNCCSHITHVNCHNRCANFGNEFNTEC 33 +A C SNCC H T ++ +RCA E N+EC Sbjct: 37 SAQCKSNCCQHDTILSL-SRCALKARE-NSEC 66 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 63,926,906 Number of Sequences: 219361 Number of extensions: 1104498 Number of successful extensions: 2590 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2507 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2588 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3304846491 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)