Clone Name | rbastl25c03 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | Y114_CHLMU (Q9PLI5) Hypothetical protein TC0114 | 101 | 9e-22 | 2 | YQU3_CAEEL (Q09550) Hypothetical protein F26C11.3 precursor | 29 | 5.9 |
---|
>Y114_CHLMU (Q9PLI5) Hypothetical protein TC0114| Length = 122 Score = 101 bits (251), Expect = 9e-22 Identities = 54/79 (68%), Positives = 60/79 (75%), Gaps = 3/79 (3%) Frame = +1 Query: 214 LLAVLPL---TPTVDRNRTVSRRSKPNSRTTFIGEQPNPWDLLQPQDVMSRHRGAKRLRR 384 +L PL PT DR++TVSRR +P+SRT IGEQPNPWDLLQPQD MSRHRGAK RR Sbjct: 33 VLGTAPLKYPAPTKDRDQTVSRRFEPSSRTALIGEQPNPWDLLQPQDAMSRHRGAKPPRR 92 Query: 385 *ELLGVISLLSPAYL*SVE 441 ELL ISLLSP YL SV+ Sbjct: 93 YELLVAISLLSPEYLLSVK 111 Score = 38.5 bits (88), Expect = 0.007 Identities = 20/40 (50%), Positives = 22/40 (55%) Frame = +3 Query: 129 QLSCPALLLA*QPVHHRLTQPSPLVLGLAPRSSPFNTNGR 248 +LS A+LLA QP HH PLVLG AP P T R Sbjct: 9 ELSYSAMLLAKQPTHHWFVHSGPLVLGTAPLKYPAPTKDR 48
>YQU3_CAEEL (Q09550) Hypothetical protein F26C11.3 precursor| Length = 1317 Score = 28.9 bits (63), Expect = 5.9 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = +3 Query: 255 PNCLTTF*TQLTYHFHRRTTEPLGPSSTPGCDESTSRCQTTPSIR 389 PNC TT QL Y+ + T + GC +++S +TPS++ Sbjct: 634 PNC-TTVLMQLIYNPSTKETRTETTTDADGCKKTSSTSSSTPSLK 677 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 70,266,784 Number of Sequences: 219361 Number of extensions: 1563108 Number of successful extensions: 4023 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3928 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4022 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2628831825 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)