| Clone Name | rbastl25a10 |
|---|---|
| Clone Library Name | barley_pub |
>LONM_HUMAN (P36776) Lon protease homolog, mitochondrial precursor (EC| 3.4.21.-) (Lon protease-like protein) (LONP) (LONHs) Length = 959 Score = 30.8 bits (68), Expect = 1.3 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = +3 Query: 12 HFNQQISQQNKMLYSLENCESIFQQDRRYIKIIVAIPIGQYSNE 143 H + ++ L L+N S F R Y+ + +IP G+YSNE Sbjct: 433 HVMDVVDEELSKLGLLDNHSSEFNVTRNYLDWLTSIPWGKYSNE 476
>CJ006_MOUSE (Q6P9P0) Protein C10orf6 homolog| Length = 1278 Score = 30.4 bits (67), Expect = 1.7 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +2 Query: 29 FPTK*NAVQSRELRKHIPTRQAIHQNHRCNSNW 127 + TK V SRE +HIP+ + ++Q H +W Sbjct: 351 YHTKSKRVLSREAPRHIPSERKVYQTHCTEDSW 383
>MEC10_CAEEL (P34886) Degenerin mec-10 (Mechanosensory abnormality protein 10)| Length = 724 Score = 30.0 bits (66), Expect = 2.3 Identities = 19/73 (26%), Positives = 36/73 (49%), Gaps = 3/73 (4%) Frame = -1 Query: 363 EKKKNRT*SCHLGLRWSDPGILKSPEKPLQSLSSRRGKREAEVAKQAIICRISLTNLSKT 184 +++ N CH +W++ E L S +++G + +E+ K+ IC SK Sbjct: 276 DRQTNDAWPCHRKEQWTNTTCQTCDEHYLCSKKAKKGTKRSELKKEPCICE------SKG 329 Query: 183 LW---HHHASILL 154 L+ H HA+++L Sbjct: 330 LFCIKHEHAAMVL 342
>LONH2_ARATH (P93655) Lon protease homolog 2, mitochondrial precursor (EC| 3.4.21.-) Length = 940 Score = 30.0 bits (66), Expect = 2.3 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = +3 Query: 12 HFNQQISQQNKMLYSLENCESIFQQDRRYIKIIVAIPIGQYSNE 143 H Q I ++ L LE S F R Y+ + +P G YSNE Sbjct: 374 HVLQVIEEELTKLQLLEASSSEFNVTRNYLDWLTILPWGNYSNE 417
>PSIP1_CHICK (Q5XXA9) Lens epithelium-derived growth factor| Length = 579 Score = 28.5 bits (62), Expect = 6.6 Identities = 18/58 (31%), Positives = 26/58 (44%) Frame = -1 Query: 411 ESKKSKRKGQDSGGRSEKKKNRT*SCHLGLRWSDPGILKSPEKPLQSLSSRRGKREAE 238 E +K+K+KG D + + KK D K EKP + + GK+EAE Sbjct: 261 EEEKAKKKGPDEKPKKQGKK-------------DEEGQKEEEKPKKEYDKKDGKKEAE 305
>LONH2_MAIZE (P93648) Lon protease homolog 2, mitochondrial precursor (EC| 3.4.21.-) Length = 964 Score = 28.5 bits (62), Expect = 6.6 Identities = 15/44 (34%), Positives = 21/44 (47%) Frame = +3 Query: 12 HFNQQISQQNKMLYSLENCESIFQQDRRYIKIIVAIPIGQYSNE 143 H Q I ++ L LE S F R Y+ + +P G YS+E Sbjct: 365 HVLQVIEEELTKLQLLEASSSEFSVTRNYLDWLTVLPWGNYSDE 408
>SYA_LACPL (Q88V10) Alanyl-tRNA synthetase (EC 6.1.1.7) (Alanine--tRNA ligase)| (AlaRS) Length = 880 Score = 28.1 bits (61), Expect = 8.6 Identities = 12/37 (32%), Positives = 23/37 (62%) Frame = +3 Query: 93 RYIKIIVAIPIGQYSNEANGTTKLRHGGAIGFWRGLS 203 +Y KI+ + IG YS E +G T +++ +G ++ +S Sbjct: 652 KYGKIVRVVSIGDYSIEFDGGTHVKNSSELGLFKIVS 688 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 58,226,291 Number of Sequences: 219361 Number of extensions: 1150458 Number of successful extensions: 3726 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 3683 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3725 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2228238148 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)