Clone Name | rbastl25a08 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | RAD9B_MOUSE (Q6WBX7) Cell cycle checkpoint control protein RAD9B... | 33 | 0.21 | 2 | RAD9B_RAT (Q499V3) Cell cycle checkpoint control protein RAD9B h... | 33 | 0.27 | 3 | DPP6_HUMAN (P42658) Dipeptidyl aminopeptidase-like protein 6 (Di... | 28 | 8.7 |
---|
>RAD9B_MOUSE (Q6WBX7) Cell cycle checkpoint control protein RAD9B homolog (RAD9| homolog B) (mRAD9B) Length = 403 Score = 33.1 bits (74), Expect = 0.21 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = -1 Query: 172 LWLCPLREGQTRRRCLSCHVVYNYLFFSSL 83 LWL P +G R SCH Y Y+ FSS+ Sbjct: 28 LWLDPSEKGLALRSVNSCHSTYGYVLFSSM 57
>RAD9B_RAT (Q499V3) Cell cycle checkpoint control protein RAD9B homolog (RAD9| homolog B) Length = 398 Score = 32.7 bits (73), Expect = 0.27 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = -1 Query: 172 LWLCPLREGQTRRRCLSCHVVYNYLFFSSL 83 LWL P +G R SCH Y Y+ FSS+ Sbjct: 23 LWLDPSEKGLALRSVNSCHSTYGYVLFSSV 52
>DPP6_HUMAN (P42658) Dipeptidyl aminopeptidase-like protein 6| (Dipeptidylpeptidase VI) (Dipeptidylpeptidase 6) (Dipeptidyl peptidase IV-like protein) (Dipeptidyl aminopeptidase-related protein) (DPPX) Length = 865 Score = 27.7 bits (60), Expect = 8.7 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -1 Query: 151 EGQTRRRCLSCHVVYNYLFFSS 86 EG R+CLSC +V N +FS+ Sbjct: 520 EGNFNRQCLSCDLVENCTYFSA 541 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 21,096,200 Number of Sequences: 219361 Number of extensions: 263048 Number of successful extensions: 491 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 479 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 491 length of database: 80,573,946 effective HSP length: 38 effective length of database: 72,238,228 effective search space used: 1733717472 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)