Clone Name | rbastl24h03 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | LOX21_HORVU (P93184) Lipoxygenase 2.1, chloroplast precursor (EC... | 37 | 0.014 | 2 | LOX22_HORVU (Q8GSM3) Lipoxygenase 2.2, chloroplast precursor (EC... | 30 | 1.3 | 3 | SPI1_PIG (Q6PKU1) Transcription factor PU.1 | 28 | 5.1 | 4 | SPI1_HUMAN (P17947) Transcription factor PU.1 (31 kDa transformi... | 28 | 5.1 | 5 | ACDE2_METTE (Q9C4Z3) Acetyl-CoA decarbonylase/synthase complex e... | 28 | 8.7 |
---|
>LOX21_HORVU (P93184) Lipoxygenase 2.1, chloroplast precursor (EC 1.13.11.12)| (LOX-100) (LOX2:Hv:1) Length = 936 Score = 37.0 bits (84), Expect = 0.014 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 190 TDEKMVMEMGIPNSISI 140 TDEKMVMEMGIPNSISI Sbjct: 920 TDEKMVMEMGIPNSISI 936
>LOX22_HORVU (Q8GSM3) Lipoxygenase 2.2, chloroplast precursor (EC 1.13.11.12)| (LOX2:Hv:2) Length = 932 Score = 30.4 bits (67), Expect = 1.3 Identities = 14/16 (87%), Positives = 14/16 (87%) Frame = -3 Query: 187 DEKMVMEMGIPNSISI 140 D K VMEMGIPNSISI Sbjct: 917 DAKTVMEMGIPNSISI 932
>SPI1_PIG (Q6PKU1) Transcription factor PU.1| Length = 270 Score = 28.5 bits (62), Expect = 5.1 Identities = 17/48 (35%), Positives = 23/48 (47%), Gaps = 7/48 (14%) Frame = +2 Query: 53 FPLYPPPGQETE--DTLIYA*LS-----YTHTQGSSNGDAVGDAHLHH 175 FPL PPP ++ DT +Y + Y + G S+ D D H HH Sbjct: 10 FPLVPPPSEDLVPYDTDLYQRQTHEYYPYLSSDGESHSDHYWDFHPHH 57
>SPI1_HUMAN (P17947) Transcription factor PU.1 (31 kDa transforming protein)| Length = 270 Score = 28.5 bits (62), Expect = 5.1 Identities = 17/48 (35%), Positives = 23/48 (47%), Gaps = 7/48 (14%) Frame = +2 Query: 53 FPLYPPPGQETE--DTLIYA*LS-----YTHTQGSSNGDAVGDAHLHH 175 FPL PPP ++ DT +Y + Y + G S+ D D H HH Sbjct: 10 FPLVPPPSEDLVPYDTDLYQRQTHEYYPYLSSDGESHSDHYWDFHPHH 57
>ACDE2_METTE (Q9C4Z3) Acetyl-CoA decarbonylase/synthase complex epsilon subunit| 2 (ACDS complex epsilon subunit 2) Length = 170 Score = 27.7 bits (60), Expect = 8.7 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = -1 Query: 78 WPGGGYNGNEHQIIIKGHDDIYI 10 WPG NGN II+ GH YI Sbjct: 99 WPGLDGNGNYDTIILLGHKKYYI 121 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 31,203,739 Number of Sequences: 219361 Number of extensions: 538110 Number of successful extensions: 1316 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1289 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1313 length of database: 80,573,946 effective HSP length: 39 effective length of database: 72,018,867 effective search space used: 1728452808 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)