Clone Name | rbastl24g07 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | Y976_TREPA (O83941) Hypothetical protein TP0976 | 34 | 0.12 | 2 | HDC_HUMAN (Q9UBI9) Headcase protein homolog (hHDC) | 28 | 6.3 |
---|
>Y976_TREPA (O83941) Hypothetical protein TP0976| Length = 459 Score = 33.9 bits (76), Expect = 0.12 Identities = 18/51 (35%), Positives = 26/51 (50%) Frame = +1 Query: 82 NTIVCTTDLPPIIGFRQMVTNANYSANFP*RIXXXXXXQARTTALVVFCSC 234 +++VC T+LP ++ F Q + N YSA RI A LV+ C C Sbjct: 84 SSVVCLTELPRLVAFSQGIPNDLYSAGA--RIARVLLLVAGVFTLVIVCLC 132
>HDC_HUMAN (Q9UBI9) Headcase protein homolog (hHDC)| Length = 543 Score = 28.1 bits (61), Expect = 6.3 Identities = 13/49 (26%), Positives = 23/49 (46%) Frame = -1 Query: 234 ARTKHDQSCRSRLG*SRSADSSREISAVVCICNHLSETDDWW*VSRAND 88 AR+ +++ CR + + D + + C HL + DW+ V R D Sbjct: 151 ARSWNEKQCRQNMWTKKGYDLAFRFCSCRCGQGHLKKDTDWYQVKRMQD 199 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 28,728,152 Number of Sequences: 219361 Number of extensions: 409417 Number of successful extensions: 938 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 927 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 938 length of database: 80,573,946 effective HSP length: 54 effective length of database: 68,728,452 effective search space used: 1649482848 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)