| Clone Name | rbastl24g03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MATK_FROFL (Q5J309) Maturase K (Intron maturase) | 30 | 1.5 | 2 | MATK_GOMPU (Q5J306) Maturase K (Intron maturase) | 29 | 2.6 | 3 | MATK_GOMHA (Q5J308) Maturase K (Intron maturase) | 29 | 2.6 | 4 | MATK_GRABR (Q95EE5) Maturase K (Intron maturase) | 28 | 4.4 | 5 | MATK_MAMHA (Q95EC9) Maturase K (Intron maturase) | 28 | 7.5 | 6 | JAK3_HUMAN (P52333) Tyrosine-protein kinase JAK3 (EC 2.7.10.2) (... | 28 | 7.5 | 7 | VL1_HPV57 (P22162) Major capsid protein L1 | 27 | 9.9 |
|---|
>MATK_FROFL (Q5J309) Maturase K (Intron maturase)| Length = 505 Score = 30.0 bits (66), Expect = 1.5 Identities = 16/44 (36%), Positives = 20/44 (45%) Frame = -1 Query: 233 WF*SESIADRLT*SLNILLASLGLSCKMHT*EY*SLKIWQCFIS 102 WF E + LLAS G S MH +Y + WQC+ S Sbjct: 267 WFFKEPFPHYVRYQGKALLASKGTSLLMHKWKYYFIYFWQCYFS 310
>MATK_GOMPU (Q5J306) Maturase K (Intron maturase)| Length = 505 Score = 29.3 bits (64), Expect = 2.6 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = -1 Query: 182 LLASLGLSCKMHT*EY*SLKIWQCFIS 102 LLAS G S MH +Y + WQC+ S Sbjct: 284 LLASKGTSLLMHKWKYYFISFWQCYFS 310
>MATK_GOMHA (Q5J308) Maturase K (Intron maturase)| Length = 505 Score = 29.3 bits (64), Expect = 2.6 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = -1 Query: 182 LLASLGLSCKMHT*EY*SLKIWQCFIS 102 LLAS G S MH +Y + WQC+ S Sbjct: 284 LLASKGTSLLMHKWKYYFISFWQCYFS 310
>MATK_GRABR (Q95EE5) Maturase K (Intron maturase)| Length = 510 Score = 28.5 bits (62), Expect = 4.4 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -1 Query: 182 LLASLGLSCKMHT*EY*SLKIWQCFIS 102 +LAS G S MH +Y + WQC+ S Sbjct: 289 ILASKGTSLLMHKWKYYLINFWQCYFS 315
>MATK_MAMHA (Q95EC9) Maturase K (Intron maturase)| Length = 510 Score = 27.7 bits (60), Expect = 7.5 Identities = 13/27 (48%), Positives = 15/27 (55%) Frame = -1 Query: 182 LLASLGLSCKMHT*EY*SLKIWQCFIS 102 +LAS G S MH +Y L WQC S Sbjct: 288 ILASKGTSLLMHKWKYYLLNFWQCHFS 314
>JAK3_HUMAN (P52333) Tyrosine-protein kinase JAK3 (EC 2.7.10.2) (Janus kinase| 3) (JAK-3) (Leukocyte janus kinase) (L-JAK) Length = 1124 Score = 27.7 bits (60), Expect = 7.5 Identities = 17/49 (34%), Positives = 24/49 (48%) Frame = +3 Query: 138 LSSMHLARQTKASQQNVQALGKTISYRL*LEPSYRGSNNRISLQCGKRI 284 L+ + LAR + Q L KT+SY+ L PS R +S +RI Sbjct: 165 LAVLDLARMAREQAQRPGELLKTVSYKACLPPSLRDLIQGLSFVTRRRI 213
>VL1_HPV57 (P22162) Major capsid protein L1| Length = 510 Score = 27.3 bits (59), Expect = 9.9 Identities = 17/66 (25%), Positives = 34/66 (51%), Gaps = 12/66 (18%) Frame = +1 Query: 43 LTIVETTRNTS-----------NYR*HSVKSEMKHCQIFKLQY-SQVCILQDRPRLASRM 186 LT+V+TTR+T+ NY+ + K ++H + + LQ+ Q+C + P + + + Sbjct: 343 LTVVDTTRSTNVSLCATVTTETNYKASNYKEYLRHMEEYDLQFIFQLCKITLTPEIMAYI 402 Query: 187 FRL*VR 204 + R Sbjct: 403 HNMDAR 408 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,610,164 Number of Sequences: 219361 Number of extensions: 533695 Number of successful extensions: 1019 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1009 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1018 length of database: 80,573,946 effective HSP length: 82 effective length of database: 62,586,344 effective search space used: 1502072256 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)