Clone Name | rbastl24e02 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | TLK1_HUMAN (Q9UKI8) Serine/threonine-protein kinase tousled-like... | 29 | 3.6 | 2 | ZNF80_PONPY (P51507) Zinc finger protein 80 | 28 | 4.7 | 3 | TLK1_MOUSE (Q8C0V0) Serine/threonine-protein kinase tousled-like... | 28 | 6.1 | 4 | RS8_GRIJA (Q9ZT56) 40S ribosomal protein S8 | 28 | 8.0 |
---|
>TLK1_HUMAN (Q9UKI8) Serine/threonine-protein kinase tousled-like 1 (EC| 2.7.11.1) (Tousled-like kinase 1) (PKU-beta) Length = 766 Score = 28.9 bits (63), Expect = 3.6 Identities = 15/38 (39%), Positives = 22/38 (57%) Frame = +1 Query: 94 LYLQAVQLQLTEAKLAVSKRGKEEDE*KKQGHMSELLR 207 L + +Q LT KLA + K +D KK+G + +LLR Sbjct: 207 LSFKIIQTDLTMLKLAALESNKIQDLEKKEGRIDDLLR 244
>ZNF80_PONPY (P51507) Zinc finger protein 80| Length = 273 Score = 28.5 bits (62), Expect = 4.7 Identities = 16/58 (27%), Positives = 28/58 (48%) Frame = +2 Query: 86 DTLYTCKQYSYNLQRQSSLSPKGGKKRMNRRSKDT*ANCSGCGRDTHLDACFYRASMT 259 + L+ CK+ + SSL+ + M +++ CS CG+ + F+R SMT Sbjct: 158 EKLFGCKECGKSFYYNSSLT-----RHMKIHTREKPYKCSECGKTFTYHSVFFRHSMT 210
>TLK1_MOUSE (Q8C0V0) Serine/threonine-protein kinase tousled-like 1 (EC| 2.7.11.1) (Tousled-like kinase 1) Length = 766 Score = 28.1 bits (61), Expect = 6.1 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = +1 Query: 94 LYLQAVQLQLTEAKLAVSKRGKEEDE*KKQGHMSELLR 207 L + Q LT KLA + K +D KK+G + +LLR Sbjct: 207 LSFKITQTDLTMLKLAALESTKNQDLEKKEGRIDDLLR 244
>RS8_GRIJA (Q9ZT56) 40S ribosomal protein S8| Length = 204 Score = 27.7 bits (60), Expect = 8.0 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +2 Query: 95 YTCKQYSYNLQRQSSLSPKGGK 160 YTCK+ Y L RQ +++ GGK Sbjct: 20 YTCKKRKYELGRQPAMTKIGGK 41 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,715,895 Number of Sequences: 219361 Number of extensions: 551301 Number of successful extensions: 1443 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1428 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1443 length of database: 80,573,946 effective HSP length: 64 effective length of database: 66,534,842 effective search space used: 1596836208 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)