Clone Name | rbastl24c08 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | CWC25_YARLI (Q6C1V6) Pre-mRNA-splicing factor CWC25 | 28 | 7.8 | 2 | ADA33_MOUSE (Q923W9) ADAM 33 precursor (EC 3.4.24.-) (A disinteg... | 28 | 7.8 | 3 | PLCG1_RAT (P10686) 1-phosphatidylinositol-4,5-bisphosphate phosp... | 28 | 7.8 |
---|
>CWC25_YARLI (Q6C1V6) Pre-mRNA-splicing factor CWC25| Length = 561 Score = 27.7 bits (60), Expect = 7.8 Identities = 23/84 (27%), Positives = 38/84 (45%), Gaps = 10/84 (11%) Frame = +2 Query: 26 LTQKQRKQRSLQRPN*RSQQCLRFA----KKKKNNGGPEGTSHHRLHYWAKQ------GI 175 +T+ R +R+ RP + + RFA K+K+ N P+G R A + G Sbjct: 405 VTRSHRDKRNSYRPEYKDEDDKRFAQRKDKEKEMNALPKGLQQMRAKLLASKKTTTVSGT 464 Query: 176 FSAHDDALTGSQLS*ASACRSDPS 247 A +GSQ + ++A S P+ Sbjct: 465 SQTPTSAPSGSQRTPSAASGSSPT 488
>ADA33_MOUSE (Q923W9) ADAM 33 precursor (EC 3.4.24.-) (A disintegrin and| metalloproteinase domain 33) Length = 797 Score = 27.7 bits (60), Expect = 7.8 Identities = 17/57 (29%), Positives = 24/57 (42%), Gaps = 7/57 (12%) Frame = -2 Query: 224 KLSSAGYRSMHRRVQKKSLVLPNNEVDGVMFPPALRCFSSSWQT-------SGIVVI 75 KL + GY H R +VL N D + +R F SW SG++V+ Sbjct: 87 KLLAPGYTETHYRPDGHPVVLSPNHTDHCQYHGRVRGFRESWVVLSTCSGMSGLIVL 143
>PLCG1_RAT (P10686) 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase| gamma 1 (EC 3.1.4.11) (Phosphoinositide phospholipase C) (PLC-gamma-1) (Phospholipase C-gamma-1) (PLC-II) (PLC-148) Length = 1290 Score = 27.7 bits (60), Expect = 7.8 Identities = 16/47 (34%), Positives = 22/47 (46%) Frame = +2 Query: 125 PEGTSHHRLHYWAKQGIFSAHDDALTGSQLS*ASACRSDPSCTHPYC 265 PE ++ HYW I S+H+ LTG Q S S+ + C C Sbjct: 319 PETMNNPLSHYW----ISSSHNTYLTGDQFSSESSLEAYARCLRMGC 361 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,514,855 Number of Sequences: 219361 Number of extensions: 859312 Number of successful extensions: 2087 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2043 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2086 length of database: 80,573,946 effective HSP length: 73 effective length of database: 64,560,593 effective search space used: 1549454232 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)