Clone Name | rbastl24c07 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | PRD15_HUMAN (P57071) PR domain zinc finger protein 15 (PR domain... | 29 | 2.5 | 2 | CDR2_CANAL (P78595) Multidrug resistance protein CDR2 | 29 | 3.2 | 3 | CDR1_CANAL (P43071) Multidrug resistance protein CDR1 | 28 | 4.2 | 4 | COX1_LUMTE (Q34941) Cytochrome c oxidase subunit 1 (EC 1.9.3.1) ... | 27 | 9.4 |
---|
>PRD15_HUMAN (P57071) PR domain zinc finger protein 15 (PR domain-containing| protein 15) (Zinc finger protein 298) Length = 1507 Score = 29.3 bits (64), Expect = 2.5 Identities = 14/41 (34%), Positives = 20/41 (48%) Frame = +2 Query: 236 HPIDVDEMVKAKTVCRLPYELHQ*CFTNCKLLQRLDMEGLW 358 H I ++ + C PYE CF+ KLL +EG+W Sbjct: 227 HEIPLNVNTHKFSDCEFPYEFCTVCFSPFKLLGMSGVEGVW 267
>CDR2_CANAL (P78595) Multidrug resistance protein CDR2| Length = 1499 Score = 28.9 bits (63), Expect = 3.2 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +3 Query: 285 CRMNSTNDALQTANCCSGSTWKDFG 359 CR++STN L++ N W++FG Sbjct: 1442 CRIDSTNQFLESINALFSQRWRNFG 1466
>CDR1_CANAL (P43071) Multidrug resistance protein CDR1| Length = 1501 Score = 28.5 bits (62), Expect = 4.2 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +3 Query: 279 AGCRMNSTNDALQTANCCSGSTWKDFG 359 A C+M+STN L++ N W++FG Sbjct: 1442 AFCQMSSTNTFLKSVNSLYSERWRNFG 1468
>COX1_LUMTE (Q34941) Cytochrome c oxidase subunit 1 (EC 1.9.3.1) (Cytochrome c| oxidase polypeptide I) Length = 513 Score = 27.3 bits (59), Expect = 9.4 Identities = 14/44 (31%), Positives = 21/44 (47%) Frame = -1 Query: 190 YCRPSLTAGFFSFFRCSGGNVAPLFMDDTSDLILYCVYYAAEHY 59 Y P L A F F +GG + + + D+IL+ YY H+ Sbjct: 331 YETPVLWALGFIFLFTTGGLTGIILSNSSLDIILHDTYYVVAHF 374 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,770,298 Number of Sequences: 219361 Number of extensions: 984263 Number of successful extensions: 1901 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1852 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1901 length of database: 80,573,946 effective HSP length: 96 effective length of database: 59,515,290 effective search space used: 1428366960 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)