Clone Name | rbastl24c05 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | TILS_CHLTE (Q8KC15) tRNA(Ile)-lysidine synthase (EC 6.3.4.-) (tR... | 28 | 6.4 | 2 | MYSP2_DROME (P35416) Paramyosin, short form (Miniparamyosin) | 28 | 8.3 |
---|
>TILS_CHLTE (Q8KC15) tRNA(Ile)-lysidine synthase (EC 6.3.4.-)| (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) Length = 331 Score = 28.5 bits (62), Expect = 6.4 Identities = 22/73 (30%), Positives = 34/73 (46%) Frame = -3 Query: 362 IGGLRRCRLS*AAIVGVISDS*ARRNFIYVEVCQGTWRRDLDDEGPSSAYPFIQN*KWLV 183 I GLR R+ AI+ + R Y+E + WR D +EG FI+N ++ Sbjct: 149 ISGLRGIRVRHGAIIRPLLPFTRREIVAYLEEKRVVWRDDHTNEGIEYDRNFIRN--RVI 206 Query: 182 KYMEMRFIDLVVP 144 +E RF ++P Sbjct: 207 PVIEERFAHKLMP 219
>MYSP2_DROME (P35416) Paramyosin, short form (Miniparamyosin)| Length = 640 Score = 28.1 bits (61), Expect = 8.3 Identities = 21/55 (38%), Positives = 27/55 (49%), Gaps = 1/55 (1%) Frame = +2 Query: 194 SSSE*KGRQKTGLHHLNLFSMSL-DKPRHR*SSALLNYPRLHRQLQLKIVDTYAD 355 SSS G+ + H+ L L DK HR SS+L N R L + V+ YAD Sbjct: 221 SSSPLDGQYRAHALHIELMDDRLVDKLDHRVSSSLHNVKRQLSTLNQRTVEFYAD 275 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 54,328,283 Number of Sequences: 219361 Number of extensions: 1004836 Number of successful extensions: 1632 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1614 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1632 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2169600302 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)