Clone Name | rbastl24b08 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | PIWL4_HUMAN (Q7Z3Z4) Piwi-like protein 4 | 29 | 2.9 | 2 | YQZ2_CAEEL (Q09320) Hypothetical protein F40B5.2 | 29 | 3.8 | 3 | RAIA_SHIFL (P0AD52) Ribosome-associated inhibitor A | 28 | 8.4 | 4 | RAIA_ECOLI (P0AD49) Ribosome-associated inhibitor A (Protein Y) ... | 28 | 8.4 | 5 | RAIA_ECOL6 (P0AD50) Ribosome-associated inhibitor A | 28 | 8.4 | 6 | RAIA_ECO57 (P0AD51) Ribosome-associated inhibitor A | 28 | 8.4 |
---|
>PIWL4_HUMAN (Q7Z3Z4) Piwi-like protein 4| Length = 852 Score = 29.3 bits (64), Expect = 2.9 Identities = 13/37 (35%), Positives = 22/37 (59%) Frame = +2 Query: 110 NTSSFFSVKTWALHITYRVVRHGSIHPSTNI*LPNYI 220 NT++ F ++TW LH ++ G I PS I + ++I Sbjct: 424 NTNARFELETWGLHFGSQISLTGRIVPSEKILMQDHI 460
>YQZ2_CAEEL (Q09320) Hypothetical protein F40B5.2| Length = 482 Score = 28.9 bits (63), Expect = 3.8 Identities = 20/65 (30%), Positives = 30/65 (46%) Frame = +3 Query: 27 LSHSHQIR*SIHPLVHSFNCFHLLYDLTIPHLFSLSKHGLYI*HTESSGTDPSIHPPTSS 206 L HS S+H + C+H+L L + +F + GLY HT+ SI P Sbjct: 186 LIHSKVAPNSVHTYLKENRCYHILLALILGFIFMFA--GLYTTHTDPIVRSASI--PMKR 241 Query: 207 YQTIS 221 +Q+ S Sbjct: 242 FQSNS 246
>RAIA_SHIFL (P0AD52) Ribosome-associated inhibitor A| Length = 112 Score = 27.7 bits (60), Expect = 8.4 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = +1 Query: 148 TYNIQSRQARIHPSIHQHLATKL 216 T NI S+Q I P+I QH+A +L Sbjct: 1 TMNITSKQMEITPAIRQHVADRL 23
>RAIA_ECOLI (P0AD49) Ribosome-associated inhibitor A (Protein Y) (SpotY) (pY)| Length = 112 Score = 27.7 bits (60), Expect = 8.4 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = +1 Query: 148 TYNIQSRQARIHPSIHQHLATKL 216 T NI S+Q I P+I QH+A +L Sbjct: 1 TMNITSKQMEITPAIRQHVADRL 23
>RAIA_ECOL6 (P0AD50) Ribosome-associated inhibitor A| Length = 112 Score = 27.7 bits (60), Expect = 8.4 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = +1 Query: 148 TYNIQSRQARIHPSIHQHLATKL 216 T NI S+Q I P+I QH+A +L Sbjct: 1 TMNITSKQMEITPAIRQHVADRL 23
>RAIA_ECO57 (P0AD51) Ribosome-associated inhibitor A| Length = 112 Score = 27.7 bits (60), Expect = 8.4 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = +1 Query: 148 TYNIQSRQARIHPSIHQHLATKL 216 T NI S+Q I P+I QH+A +L Sbjct: 1 TMNITSKQMEITPAIRQHVADRL 23 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34,223,309 Number of Sequences: 219361 Number of extensions: 555212 Number of successful extensions: 1229 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1210 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1229 length of database: 80,573,946 effective HSP length: 49 effective length of database: 69,825,257 effective search space used: 1675806168 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)