Clone Name | rbastl24b06 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | Y634_METJA (Q58051) Hypothetical UPF0069 protein MJ0634 | 28 | 6.2 |
---|
>Y634_METJA (Q58051) Hypothetical UPF0069 protein MJ0634| Length = 620 Score = 28.1 bits (61), Expect = 6.2 Identities = 20/56 (35%), Positives = 27/56 (48%), Gaps = 4/56 (7%) Frame = +1 Query: 88 LGFLGSYQHTDGLTLSCI*DCRGREQEKGRSMFVSPVHEIG----SPYDSDLNSRV 243 LGFLG +G+ +GRE RS F+ V+EI S Y S L+ R+ Sbjct: 135 LGFLGKRLLEEGVKFIDFSKIKGREAGIARSNFLDKVYEIMREYISRYPSGLDKRI 190 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,441,662 Number of Sequences: 219361 Number of extensions: 678617 Number of successful extensions: 1449 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1444 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1449 length of database: 80,573,946 effective HSP length: 63 effective length of database: 66,754,203 effective search space used: 1602100872 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)