Clone Name | rbastl24b05 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | PRT1_ARATH (Q8LBL5) Ubiquitin protein ligase PRT1 (EC 6.3.2.-) (... | 32 | 0.53 | 2 | MRP8_ARATH (Q8VZZ4) Multidrug resistance-associated protein 8 (E... | 31 | 0.69 |
---|
>PRT1_ARATH (Q8LBL5) Ubiquitin protein ligase PRT1 (EC 6.3.2.-) (Proteolysis 1| protein) Length = 410 Score = 31.6 bits (70), Expect = 0.53 Identities = 13/36 (36%), Positives = 18/36 (50%) Frame = -3 Query: 156 IIILPSHLSIFFCIHSSIFNFNFEDLVFCSSVLVHF 49 I++ HLS F+C+H S+ F C VHF Sbjct: 37 IVLSCGHLSCFWCVHKSMNGFRESHCPICRDPYVHF 72
>MRP8_ARATH (Q8VZZ4) Multidrug resistance-associated protein 8 (EC 3.6.3.44)| (Glutathione S-conjugate transporting ATPase 8) (ATP-energized glutathione S-conjugate pump 8) Length = 1466 Score = 31.2 bits (69), Expect = 0.69 Identities = 26/81 (32%), Positives = 37/81 (45%), Gaps = 1/81 (1%) Frame = -3 Query: 258 AIMNHENGVLLRQQFSYNR-VLFCDVL*HS*IVVNIIILPSHLSIFFCIHSSIFNFNFED 82 AIMN E FSYN+ VL C V++ + S LS+ C+H + F D Sbjct: 47 AIMNEE---FKHISFSYNKLVLIC--------CVSLSVFYSVLSLLSCLHWHTNGWPFLD 95 Query: 81 LVFCSSVLVHFSVYYSG*FTS 19 L+ + SVY G +T+ Sbjct: 96 LLLAALTWGSISVYLFGRYTN 116 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34,257,616 Number of Sequences: 219361 Number of extensions: 486656 Number of successful extensions: 827 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 823 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 827 length of database: 80,573,946 effective HSP length: 78 effective length of database: 63,463,788 effective search space used: 1523130912 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)