| Clone Name | rbastl24b03 |
|---|---|
| Clone Library Name | barley_pub |
>SEC_ARATH (Q9M8Y0) Probable UDP-N-acetylglucosamine--peptide| N-acetylglucosaminyltransferase SEC (EC 2.4.1.-) (Protein SECRET AGENT) Length = 977 Score = 32.3 bits (72), Expect = 0.29 Identities = 13/21 (61%), Positives = 17/21 (80%) Frame = -3 Query: 372 SGRHPEPFKVKEDDSEFPYDR 310 SG+ P+ FKV E+D EFP+DR Sbjct: 957 SGQQPQHFKVLENDLEFPHDR 977
>PAC11_YEAST (P40960) Protein PAC11| Length = 533 Score = 29.6 bits (65), Expect = 1.9 Identities = 16/45 (35%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = -1 Query: 224 PVPYRPL-RVEFDLCTQERRM*QV*SCDEIGLAYLCVPTEDYSFV 93 PVP L +E D CT R+ ++ DE+G+A + +ED +V Sbjct: 354 PVPLSQLLSLENDTCTYTERLQRLAKFDEVGIACMAYTSEDPQYV 398
>Y3032_BACAN (Q6HX62) Putative adenine deaminase BA3032/GBAA3032/BAS2818 (EC| 3.5.4.2) (Adenase) (Adenine aminase) Length = 584 Score = 28.5 bits (62), Expect = 4.1 Identities = 16/64 (25%), Positives = 26/64 (40%), Gaps = 6/64 (9%) Frame = +2 Query: 137 RSHHKTKPATFFFLGYISRTPHAKVYMVQDRA------QPDELHDCTMLQLCFLSTQPGF 298 RS HK + YI A +++ DR P++LH+C ++ P + Sbjct: 24 RSPHKLLKNATYLNSYIREWMQANIWIYDDRIIYVGEKLPEQLHECEVIDCDGKYVVPSY 83 Query: 299 HAPH 310 PH Sbjct: 84 IEPH 87
>LIFR_MOUSE (P42703) Leukemia inhibitory factor receptor precursor (LIF| receptor) (LIF-R) (D-factor/LIF receptor) (CD118 antigen) Length = 1092 Score = 28.1 bits (61), Expect = 5.4 Identities = 16/48 (33%), Positives = 22/48 (45%), Gaps = 3/48 (6%) Frame = +2 Query: 218 VQDRAQPDELHDCTMLQLCFL---STQPGFHAPHLSYGNSLSSSFTLN 352 V+D D H C L+ + + PG H ++Y N S FTLN Sbjct: 76 VKDICIKDRFHSCHPLETTNVKIPALSPGDHEVTINYLNGFQSKFTLN 123
>XFP_BIFAN (Q9AEM9) Xylulose-5-phosphate/fructose-6-phosphate phosphoketolase| (EC 4.1.2.9) (EC 4.1.2.22) Length = 825 Score = 28.1 bits (61), Expect = 5.4 Identities = 14/26 (53%), Positives = 16/26 (61%) Frame = +2 Query: 104 NLLLAHINRLIRSHHKTKPATFFFLG 181 N LLAHINRLI H + T F +G Sbjct: 72 NFLLAHINRLIADHQQN---TVFIMG 94
>LIFR_RAT (O70535) Leukemia inhibitory factor receptor precursor (LIF| receptor) (LIF-R) (CD118 antigen) Length = 1093 Score = 28.1 bits (61), Expect = 5.4 Identities = 16/48 (33%), Positives = 22/48 (45%), Gaps = 3/48 (6%) Frame = +2 Query: 218 VQDRAQPDELHDCTMLQLCFL---STQPGFHAPHLSYGNSLSSSFTLN 352 V+D D H C L+ + + PG H ++Y N S FTLN Sbjct: 77 VKDICIKDRPHSCHRLETTNVKIPALSPGDHEVTINYQNGFQSKFTLN 124
>GRPE_MYCCA (P71499) Protein grpE (HSP-70 cofactor)| Length = 206 Score = 27.7 bits (60), Expect = 7.1 Identities = 8/26 (30%), Positives = 17/26 (65%) Frame = +2 Query: 71 NSTTIRNQQNYNLLLAHINRLIRSHH 148 N +RN + + ++++ IN ++ SHH Sbjct: 118 NEVVLRNVKGFEMIVSQINNVLESHH 143
>PCDLK_HUMAN (Q9BYE9) Protocadherin LKC precursor (PC-LKC)| Length = 1310 Score = 27.3 bits (59), Expect = 9.2 Identities = 20/59 (33%), Positives = 28/59 (47%), Gaps = 2/59 (3%) Frame = +2 Query: 179 GYISRTPHAKVYMVQDRAQPDELHDCTML--QLCFLSTQPGFHAPHLSYGNSLSSSFTL 349 G+ S + VY+ Q +A E D L + C L+T PGF A Y N+ S T+ Sbjct: 864 GWFSVAANGSVYINQSKAIDYEACDLVTLVVRACDLATDPGFQA----YSNNGSLLITI 918
>FTSK_PSEU2 (Q9Z3U1) DNA translocase ftsK| Length = 801 Score = 27.3 bits (59), Expect = 9.2 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = -1 Query: 368 AVIRSRLR*KKTTVSSHMTDEEHEIPAV 285 A R RL ++ ++S HMT+ E +PAV Sbjct: 247 AKARERLVEREASLSKHMTEREKHVPAV 274
>YORA_BPP1 (Q06262) Hypothetical 36.0 kDa protein in doc-Gp10 intergenic| region (ORFA) Length = 312 Score = 27.3 bits (59), Expect = 9.2 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = +3 Query: 33 QCQHSDSSTSWG*IVQQSGTNKTIIFCWH 119 QCQ +D S IV N ++ CWH Sbjct: 58 QCQAADRSWCDNHIVHAERDNSAVLLCWH 86
>ENGB_BUCAI (P57507) Probable GTP-binding protein engB| Length = 205 Score = 27.3 bits (59), Expect = 9.2 Identities = 18/49 (36%), Positives = 27/49 (55%) Frame = -2 Query: 187 YVPKKEECSRFSLVMRSD*PIYVCQQKIIVLLVPDCCTIQPQLVLLSEC 41 Y+ K+E+ F L+M P+ QKII + V +I LVLL++C Sbjct: 102 YLEKREQIKLFVLLMDIRYPLKKLDQKIISIAVQKKISI---LVLLTKC 147 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 54,607,192 Number of Sequences: 219361 Number of extensions: 1044465 Number of successful extensions: 2452 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 2389 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2452 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 1407308304 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)