| Clone Name | rbastl24a09 |
|---|---|
| Clone Library Name | barley_pub |
>LONM_HUMAN (P36776) Lon protease homolog, mitochondrial precursor (EC| 3.4.21.-) (Lon protease-like protein) (LONP) (LONHs) Length = 959 Score = 30.8 bits (68), Expect = 0.96 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = +1 Query: 7 HFNQQISQQNKMLYSLENCESIFQQDRRYIKIIVAIPIGQYSNE 138 H + ++ L L+N S F R Y+ + +IP G+YSNE Sbjct: 433 HVMDVVDEELSKLGLLDNHSSEFNVTRNYLDWLTSIPWGKYSNE 476
>CJ006_MOUSE (Q6P9P0) Protein C10orf6 homolog| Length = 1278 Score = 30.4 bits (67), Expect = 1.3 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +3 Query: 24 FPTK*NAVQSRELRKHIPTRQAIHQNHRCNSNW 122 + TK V SRE +HIP+ + ++Q H +W Sbjct: 351 YHTKSKRVLSREAPRHIPSERKVYQTHCTEDSW 383
>LONH2_ARATH (P93655) Lon protease homolog 2, mitochondrial precursor (EC| 3.4.21.-) Length = 940 Score = 30.0 bits (66), Expect = 1.6 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = +1 Query: 7 HFNQQISQQNKMLYSLENCESIFQQDRRYIKIIVAIPIGQYSNE 138 H Q I ++ L LE S F R Y+ + +P G YSNE Sbjct: 374 HVLQVIEEELTKLQLLEASSSEFNVTRNYLDWLTILPWGNYSNE 417
>LONH2_MAIZE (P93648) Lon protease homolog 2, mitochondrial precursor (EC| 3.4.21.-) Length = 964 Score = 28.5 bits (62), Expect = 4.8 Identities = 15/44 (34%), Positives = 21/44 (47%) Frame = +1 Query: 7 HFNQQISQQNKMLYSLENCESIFQQDRRYIKIIVAIPIGQYSNE 138 H Q I ++ L LE S F R Y+ + +P G YS+E Sbjct: 365 HVLQVIEEELTKLQLLEASSSEFSVTRNYLDWLTVLPWGNYSDE 408
>SYA_LACPL (Q88V10) Alanyl-tRNA synthetase (EC 6.1.1.7) (Alanine--tRNA ligase)| (AlaRS) Length = 880 Score = 28.1 bits (61), Expect = 6.2 Identities = 12/37 (32%), Positives = 23/37 (62%) Frame = +1 Query: 88 RYIKIIVAIPIGQYSNEANGTTKLRHGGAIGFWRGLS 198 +Y KI+ + IG YS E +G T +++ +G ++ +S Sbjct: 652 KYGKIVRVVSIGDYSIEFDGGTHVKNSSELGLFKIVS 688
>ALG6_SCHPO (O43053) Probable dolichyl pyrophosphate Man9GlcNAc2| alpha-1,3-glucosyltransferase (EC 2.4.1.-) (Dolichyl-P-Glc:Man9GlcNAc2-PP-dolichyl glucosyltransferase) Length = 506 Score = 27.7 bits (60), Expect = 8.2 Identities = 13/41 (31%), Positives = 22/41 (53%), Gaps = 5/41 (12%) Frame = +3 Query: 144 WYNKIEAWWC-----HRVLERFVREILQIIACLATSASLLP 251 W +K+ +WC ++ E F LQ+I+ + T S+LP Sbjct: 290 WEDKVANFWCTLNTVFKIREVFTLHQLQVISLIFTLISILP 330 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,263,910 Number of Sequences: 219361 Number of extensions: 701761 Number of successful extensions: 2626 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2617 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2626 length of database: 80,573,946 effective HSP length: 59 effective length of database: 67,631,647 effective search space used: 1623159528 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)