Clone Name | rbastl24a08 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | IPNS_STRCT (Q53932) Isopenicillin N synthetase (EC 1.21.3.1) (IP... | 30 | 3.0 | 2 | SYV_ONYPE (Q6YRJ6) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--t... | 29 | 3.9 | 3 | LASS1_MOUSE (P27545) LAG1 longevity assurance homolog 1 (UOG-1 p... | 29 | 3.9 | 4 | LASS1_HUMAN (P27544) LAG1 longevity assurance homolog 1 (UOG-1 p... | 28 | 8.8 |
---|
>IPNS_STRCT (Q53932) Isopenicillin N synthetase (EC 1.21.3.1) (IPNS)| (Isopenicillin N synthase) Length = 321 Score = 29.6 bits (65), Expect = 3.0 Identities = 21/72 (29%), Positives = 31/72 (43%), Gaps = 10/72 (13%) Frame = -1 Query: 407 RQRWQVLRRGREVLEGW------LGLGRRVVDGG----EVQLGVGEQRSPWEAHGGERHQ 258 R + + R GRE +E W G ++ G EV + E+R P GE++ Sbjct: 87 RNGYYMARPGRETVESWCYLNPSFGEDHPMMKAGTPMHEVNVWPDEERHPDFGSFGEQYH 146 Query: 257 LQGLAVRLACCG 222 + A R CCG Sbjct: 147 REVSASRRCCCG 158
>SYV_ONYPE (Q6YRJ6) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 882 Score = 29.3 bits (64), Expect = 3.9 Identities = 15/30 (50%), Positives = 19/30 (63%) Frame = +3 Query: 276 VSFPWRTLLSDAELYFSSVDDATTKPEPTF 365 V FP + LSDA L S ++ ATT+PE F Sbjct: 204 VDFPTNSNLSDASLVPSFLEIATTRPETMF 233
>LASS1_MOUSE (P27545) LAG1 longevity assurance homolog 1 (UOG-1 protein)| Length = 350 Score = 29.3 bits (64), Expect = 3.9 Identities = 19/58 (32%), Positives = 26/58 (44%), Gaps = 4/58 (6%) Frame = -1 Query: 332 DGGEVQLGVGEQRSPWEAHGGERHQLQGLAVRLACCGFFSKMFVYGWL----FPVSKL 171 D +VQL + ++A GG H+L GL L C F F + W FP+ L Sbjct: 210 DVSDVQLEFTKLNIYFKARGGAYHRLHGLVANLGCLSF---CFCWFWFRLYWFPLKVL 264
>LASS1_HUMAN (P27544) LAG1 longevity assurance homolog 1 (UOG-1 protein) (LAG1| protein) Length = 350 Score = 28.1 bits (61), Expect = 8.8 Identities = 18/55 (32%), Positives = 27/55 (49%), Gaps = 1/55 (1%) Frame = -1 Query: 332 DGGEVQLGVGEQRSPWEAHGGERHQLQGLAVRLACCGF-FSKMFVYGWLFPVSKL 171 D +VQL + +++ GG H+L LA L C F FS + + FP+ L Sbjct: 210 DISDVQLEFTKLNIYFKSRGGSYHRLHALAADLGCLSFGFSWFWFRLYWFPLKVL 264 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53,409,798 Number of Sequences: 219361 Number of extensions: 951504 Number of successful extensions: 2914 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2711 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2911 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2286875994 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)