| Clone Name | rbastl23h09 |
|---|---|
| Clone Library Name | barley_pub |
>EUTP_SALTY (P0A208) Ethanolamine utilization protein eutP| Length = 159 Score = 29.3 bits (64), Expect = 2.9 Identities = 13/20 (65%), Positives = 13/20 (65%), Gaps = 1/20 (5%) Frame = -1 Query: 156 EFERHG-ID*PGRYFIHTRW 100 EF HG ID PG YF H RW Sbjct: 35 EFNDHGDIDTPGEYFSHPRW 54
>EUTP_SALTI (P0A209) Ethanolamine utilization protein eutP| Length = 159 Score = 29.3 bits (64), Expect = 2.9 Identities = 13/20 (65%), Positives = 13/20 (65%), Gaps = 1/20 (5%) Frame = -1 Query: 156 EFERHG-ID*PGRYFIHTRW 100 EF HG ID PG YF H RW Sbjct: 35 EFNDHGDIDTPGEYFSHPRW 54
>GID_BACSK (Q5WFP8) tRNA uridine 5-carboxymethylaminomethyl modification| enzyme gid Length = 436 Score = 28.5 bits (62), Expect = 5.0 Identities = 13/53 (24%), Positives = 22/53 (41%) Frame = -2 Query: 176 SRLTCGRNLKGTALINPVDILYTRAGHFDGAFLHCKTSVTACTYGDVILDVND 18 + L C +L+G +L N V +L H D + G + +D +D Sbjct: 50 AELVCSNSLRGNSLANAVGVLKEEMRHLDSVIIKAADEAAVPAGGALAVDRHD 102
>GID_STAES (Q8CPH2) tRNA uridine 5-carboxymethylaminomethyl modification| enzyme gid Length = 435 Score = 28.1 bits (61), Expect = 6.6 Identities = 14/53 (26%), Positives = 22/53 (41%) Frame = -2 Query: 176 SRLTCGRNLKGTALINPVDILYTRAGHFDGAFLHCKTSVTACTYGDVILDVND 18 + L C +L+G AL N V +L H D + G + +D +D Sbjct: 48 AELVCSNSLRGNALTNAVGVLKEEMRHLDSLIITSADKARVPAGGALAVDRHD 100
>GID_STAEQ (Q5HPU1) tRNA uridine 5-carboxymethylaminomethyl modification| enzyme gid Length = 435 Score = 28.1 bits (61), Expect = 6.6 Identities = 14/53 (26%), Positives = 22/53 (41%) Frame = -2 Query: 176 SRLTCGRNLKGTALINPVDILYTRAGHFDGAFLHCKTSVTACTYGDVILDVND 18 + L C +L+G AL N V +L H D + G + +D +D Sbjct: 48 AELVCSNSLRGNALTNAVGVLKEEMRHLDSLIITSADKARVPAGGALAVDRHD 100 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 28,776,446 Number of Sequences: 219361 Number of extensions: 484231 Number of successful extensions: 1326 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1272 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1320 length of database: 80,573,946 effective HSP length: 43 effective length of database: 71,141,423 effective search space used: 1707394152 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)