Clone Name | rbastl23b02 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | BC11B_HUMAN (Q9C0K0) B-cell lymphoma/leukemia 11B (B-cell CLL/ly... | 31 | 1.1 | 2 | AXL1_YEAST (P40851) Putative protease AXL1 (EC 3.4.99.-) | 28 | 5.4 |
---|
>BC11B_HUMAN (Q9C0K0) B-cell lymphoma/leukemia 11B (B-cell CLL/lymphoma 11B)| (Radiation-induced tumor suppressor gene 1 protein) (hRit1) (COUP-TF-interacting protein 2) Length = 894 Score = 30.8 bits (68), Expect = 1.1 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +3 Query: 24 LPPCL*MPCCNVSRYVQNGLKGNLLTLRPF 113 LPPCL +PCC+ +G +G T PF Sbjct: 177 LPPCLPLPCCSARPVSGDGTQGEGQTEAPF 206
>AXL1_YEAST (P40851) Putative protease AXL1 (EC 3.4.99.-)| Length = 1208 Score = 28.5 bits (62), Expect = 5.4 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = +3 Query: 3 YSTGNTMLPPCL*MPCCNVSRYVQNGLKGNLLTLRPFQVLDRPS 134 + TGN LP C+ P +++ LK TLRP Q+ P+ Sbjct: 574 FPTGNLFLPDCVSDPLKLQQLFLECSLKSKFATLRP-QIYSEPT 616 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 22,751,361 Number of Sequences: 219361 Number of extensions: 304558 Number of successful extensions: 567 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 563 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 567 length of database: 80,573,946 effective HSP length: 21 effective length of database: 75,967,365 effective search space used: 1823216760 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)