Clone Name | rbastl23b01 |
---|---|
Clone Library Name | barley_pub |
>Y2948_STRCO (Q9L1U6) UPF0301 protein SCO2948| Length = 193 Score = 36.6 bits (83), Expect = 0.015 Identities = 17/26 (65%), Positives = 19/26 (73%) Frame = -1 Query: 348 LWFFLGYAGRGYSQLFDELSEGAWHV 271 L F GYAG G QL DEL+EGAW+V Sbjct: 127 LRIFAGYAGWGPGQLEDELTEGAWYV 152
>BC11B_HUMAN (Q9C0K0) B-cell lymphoma/leukemia 11B (B-cell CLL/lymphoma 11B)| (Radiation-induced tumor suppressor gene 1 protein) (hRit1) (COUP-TF-interacting protein 2) Length = 894 Score = 35.4 bits (80), Expect = 0.033 Identities = 21/62 (33%), Positives = 29/62 (46%), Gaps = 7/62 (11%) Frame = +1 Query: 82 CREATLPKIPVASAGVKRYSTGNTM-------LPPCL*MPCCNVSRYVQNGLKGNLLTLR 240 CR A LP + +A +S+ T LPPCL +PCC+ +G +G T Sbjct: 145 CRPAQLPAVAPIAASSHPHSSVITSPLRALGALPPCLPLPCCSARPVSGDGTQGEGQTEA 204 Query: 241 PF 246 PF Sbjct: 205 PF 206
>Y5129_STRAW (Q82D55) UPF0301 protein SAV5129| Length = 193 Score = 35.4 bits (80), Expect = 0.033 Identities = 17/26 (65%), Positives = 18/26 (69%) Frame = -1 Query: 348 LWFFLGYAGRGYSQLFDELSEGAWHV 271 L F GYAG G QL DEL EGAW+V Sbjct: 127 LRIFAGYAGWGPGQLEDELVEGAWYV 152
>KRA93_HUMAN (Q9BYQ3) Keratin-associated protein 9-3 (Keratin-associated protein| 9.3) (Ultrahigh sulfur keratin-associated protein 9.3) Length = 159 Score = 31.2 bits (69), Expect = 0.63 Identities = 15/56 (26%), Positives = 20/56 (35%) Frame = +1 Query: 28 PTICAPKCAKTNSDQNNLCREATLPKIPVASAGVKRYSTGNTMLPPCL*MPCCNVS 195 PT C C +++S CR V G S G+ PC CC + Sbjct: 83 PTCCGSSCGQSSSCAPVYCRRTCYHPTSVCLPGCLNQSCGSNCCQPCCRPACCETT 138
>MURB_PROMT (Q46I41) UDP-N-acetylenolpyruvoylglucosamine reductase (EC| 1.1.1.158) (UDP-N-acetylmuramate dehydrogenase) Length = 291 Score = 31.2 bits (69), Expect = 0.63 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = -2 Query: 380 GSEWASNLPRTCGFSLATLVGATANCLMSYLK 285 G EWA +P T G ++ GA +C+ SYL+ Sbjct: 110 GFEWAVGIPGTIGGAVVMNAGAQEHCISSYLE 141
>AXL1_YEAST (P40851) Putative protease AXL1 (EC 3.4.99.-)| Length = 1208 Score = 30.4 bits (67), Expect = 1.1 Identities = 16/48 (33%), Positives = 23/48 (47%) Frame = +1 Query: 136 YSTGNTMLPPCL*MPCCNVSRYVQNGLKGNLLTLRPFQVLDRPSTNMP 279 + TGN LP C+ P +++ LK TLRP Q+ P+ P Sbjct: 574 FPTGNLFLPDCVSDPLKLQQLFLECSLKSKFATLRP-QIYSEPTRTKP 620
>Y2927_COREF (Q8FSW7) UPF0301 protein CE2927| Length = 201 Score = 30.0 bits (66), Expect = 1.4 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = -1 Query: 354 EDLWFFLGYAGRGYSQLFDELSEGAWHVS 268 E + FF GYA QL DE+ +G W+V+ Sbjct: 133 EGMRFFAGYAEWAPGQLNDEIEQGDWYVA 161
>KRA94_HUMAN (Q9BYQ2) Keratin-associated protein 9-4 (Keratin-associated protein| 9.4) (Ultrahigh sulfur keratin-associated protein 9.4) Length = 154 Score = 30.0 bits (66), Expect = 1.4 Identities = 15/56 (26%), Positives = 20/56 (35%) Frame = +1 Query: 28 PTICAPKCAKTNSDQNNLCREATLPKIPVASAGVKRYSTGNTMLPPCL*MPCCNVS 195 PT C C +++S CR V G S G+ PC CC + Sbjct: 83 PTCCGSSCDQSSSCAPVYCRRTCYYPTTVCLPGCLNQSCGSNCCQPCCRPACCETT 138
>BC11B_MOUSE (Q99PV8) B-cell lymphoma/leukemia 11B (B-cell CLL/lymphoma 11B)| (Radiation-induced tumor suppressor gene 1 protein) (mRit1) (COUP-TF-interacting protein 2) Length = 884 Score = 29.6 bits (65), Expect = 1.8 Identities = 19/63 (30%), Positives = 29/63 (46%), Gaps = 8/63 (12%) Frame = +1 Query: 82 CREATLPKI-PVASAGVKRYSTGNT-------MLPPCL*MPCCNVSRYVQNGLKGNLLTL 237 CR A LP + P+A++ ++ T +LPPC +PCC +G +G Sbjct: 144 CRPAQLPSMAPIAASSSHPPTSVITSPLRALGVLPPCFPLPCCGARPISGDGTQGEGQME 203 Query: 238 RPF 246 PF Sbjct: 204 APF 206
>KRA11_HUMAN (Q07627) Keratin-associated protein 1-1 (Keratin-associated protein| 1.1) (High sulfur keratin-associated protein 1.1) (Keratin-associated protein 1.6) (Keratin-associated protein 1.7) Length = 177 Score = 29.6 bits (65), Expect = 1.8 Identities = 16/55 (29%), Positives = 21/55 (38%), Gaps = 2/55 (3%) Frame = +1 Query: 37 CAPKCAKTNSDQNNLCREATLPK--IPVASAGVKRYSTGNTMLPPCL*MPCCNVS 195 C P C +T+S Q C + + G +STG T C CC S Sbjct: 25 CQPSCCETSSCQPRCCETSCCQPSCCQTSFCGFPSFSTGGTCDSSCCQPSCCETS 79
>ADH6_RAT (Q5XI95) Alcohol dehydrogenase 6 (EC 1.1.1.1)| Length = 376 Score = 29.3 bits (64), Expect = 2.4 Identities = 13/37 (35%), Positives = 20/37 (54%), Gaps = 3/37 (8%) Frame = +1 Query: 34 ICAPKCAKTNS---DQNNLCREATLPKIPVASAGVKR 135 +C P+C + + +NN+C E L K +AS G R Sbjct: 94 LCIPQCGECKTCLNSKNNICTEIRLSKTHLASEGTSR 130
>NIR_MAIZE (P17847) Ferredoxin--nitrite reductase, chloroplast precursor (EC| 1.7.7.1) (Fragment) Length = 569 Score = 28.9 bits (63), Expect = 3.1 Identities = 27/84 (32%), Positives = 39/84 (46%), Gaps = 1/84 (1%) Frame = +1 Query: 40 APKCAKTNSDQNNLCREATLPKIPVASAGVKRYSTGNTMLPPCL*MPCCNVSRYVQNGLK 219 A CA + QN R TLP +P G++ + G T L + NV V N L Sbjct: 139 ADGCADVTTRQNWQIRGVTLPDVPAILDGLR--AVGLTSLQSGM----DNVRNPVGNPLA 192 Query: 220 GNLLTLRPFQVLD-RPSTNMPCSF 288 G + P +++D RP TN+ S+ Sbjct: 193 G----VDPHEIVDTRPYTNLLSSY 212
>CFAI_MOUSE (Q61129) Complement factor I precursor (EC 3.4.21.45) (C3B/C4B| inactivator) [Contains: Complement factor I heavy chain; Complement factor I light chain] Length = 603 Score = 28.9 bits (63), Expect = 3.1 Identities = 15/39 (38%), Positives = 20/39 (51%), Gaps = 2/39 (5%) Frame = +2 Query: 68 IRTTCVEKLP--CPKFP*PRQALNATVQETQCYHHASEC 178 I TC+ KLP CP+ P A+N T C+ + EC Sbjct: 58 IEGTCICKLPYQCPRAGTPVCAMNGRSYPTYCHQKSFEC 96
>KRA98_HUMAN (Q9BYQ0) Keratin-associated protein 9-8 (Keratin-associated protein| 9.8) (Ultrahigh sulfur keratin-associated protein 9.8) Length = 159 Score = 28.5 bits (62), Expect = 4.1 Identities = 14/55 (25%), Positives = 20/55 (36%) Frame = +1 Query: 31 TICAPKCAKTNSDQNNLCREATLPKIPVASAGVKRYSTGNTMLPPCL*MPCCNVS 195 T C C +++S CR V G S G++ PC CC + Sbjct: 84 TSCGSSCGQSSSCAPVYCRRTCYHPTTVCLPGCLNQSCGSSCCQPCCRPACCETT 138
>KRA99_HUMAN (Q9BYP9) Keratin-associated protein 9-9 (Keratin-associated protein| 9.9) (Ultrahigh sulfur keratin-associated protein 9.9) Length = 154 Score = 28.1 bits (61), Expect = 5.3 Identities = 14/55 (25%), Positives = 20/55 (36%) Frame = +1 Query: 31 TICAPKCAKTNSDQNNLCREATLPKIPVASAGVKRYSTGNTMLPPCL*MPCCNVS 195 T C C +++S CR V G S G++ PC CC + Sbjct: 79 TSCGSSCGQSSSCAPVYCRRTCYYPTTVCLPGCLNQSCGSSCCQPCCRPACCETT 133
>KRA95_HUMAN (Q9BYQ1) Keratin-associated protein 9-5 (Keratin-associated protein| 9.5) (Ultrahigh sulfur keratin-associated protein 9.5) (Fragment) Length = 111 Score = 28.1 bits (61), Expect = 5.3 Identities = 14/55 (25%), Positives = 20/55 (36%) Frame = +1 Query: 31 TICAPKCAKTNSDQNNLCREATLPKIPVASAGVKRYSTGNTMLPPCL*MPCCNVS 195 T C C +++S CR V G S G++ PC CC + Sbjct: 36 TSCGSSCGQSSSCAPVYCRRTCYYPTTVCLPGCLNQSCGSSCCQPCCRPACCETT 90
>Y3485_CHRVO (Q7NSE1) UPF0060 membrane protein CV_3485| Length = 113 Score = 28.1 bits (61), Expect = 5.3 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = -2 Query: 374 EWASNLPRTCGFSLATLVGATANCLMSYLKEHGMLVEGRS 255 EW + LPR G + T + C + +L +L EGRS Sbjct: 2 EWLTGLPRVAGLFVLTALAEIVGCYLPWL----VLREGRS 37
>KRA92_HUMAN (Q9BYQ4) Keratin-associated protein 9-2 (Keratin-associated protein| 9.2) (Ultrahigh sulfur keratin-associated protein 9.2) Length = 174 Score = 27.7 bits (60), Expect = 7.0 Identities = 14/55 (25%), Positives = 19/55 (34%) Frame = +1 Query: 31 TICAPKCAKTNSDQNNLCREATLPKIPVASAGVKRYSTGNTMLPPCL*MPCCNVS 195 T C C +++S CR V G S G+ PC CC + Sbjct: 99 TSCGSSCGQSSSCAPVYCRRTCYYPTTVCLPGCLNQSCGSNCCQPCCRPACCETT 153
>ADH6_PERMA (P41681) Alcohol dehydrogenase 6 (EC 1.1.1.1) (Alcohol| dehydrogenase 2) (ADH-2) Length = 375 Score = 27.7 bits (60), Expect = 7.0 Identities = 12/37 (32%), Positives = 20/37 (54%), Gaps = 3/37 (8%) Frame = +1 Query: 34 ICAPKCAKTNS---DQNNLCREATLPKIPVASAGVKR 135 +C P+C + N+ +NN+C+E L + S G R Sbjct: 94 LCLPQCGECNTCLNSKNNICKEVRLSGTHLTSEGNSR 130
>ITK_MOUSE (Q03526) Tyrosine-protein kinase ITK/TSK (EC 2.7.10.2)| (T-cell-specific kinase) (IL-2-inducible T-cell kinase) (Kinase EMT) (Kinase TLK) Length = 625 Score = 27.7 bits (60), Expect = 7.0 Identities = 21/56 (37%), Positives = 26/56 (46%), Gaps = 3/56 (5%) Frame = +2 Query: 227 F*LSGHSRC---LIGPPLTCHAPSDSSSNSWL*PRPA*PRKNHRSSADCSPTLIPA 385 F + G RC L P + C AP D S N+ P P P N RS + TL+ A Sbjct: 130 FWMDGRWRCCSQLEKPAVGC-APYDPSKNASKKPLPPTPEDNRRSFQEPEETLVIA 184
>Y3084_CORGL (Q8NL65) UPF0301 protein Cgl3084/cg3414| Length = 189 Score = 27.3 bits (59), Expect = 9.1 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -1 Query: 354 EDLWFFLGYAGRGYSQLFDELSEGAWHVS 268 E + FF GYA QL +E+ +G W V+ Sbjct: 121 EGMRFFAGYAEWAPGQLNEEIEQGDWFVT 149
>MSH6_DROME (Q9VUM0) Probable DNA mismatch repair protein MSH6| Length = 1190 Score = 27.3 bits (59), Expect = 9.1 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +1 Query: 178 PCCNVSRYVQNGLKGNLLTLRPFQVLDRPS 267 PC N S Y+ NGL+ + P +L P+ Sbjct: 931 PCANASTYIPNGLELGTASEAPLSLLTGPN 960 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 62,897,284 Number of Sequences: 219361 Number of extensions: 1306766 Number of successful extensions: 3126 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 3041 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3125 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 1386249648 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)