| Clone Name | rbastl22h05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CAGT_HELPY (P97245) CAG pathogenicity island protein 12 precursor | 28 | 7.4 | 2 | CAGT_HELPJ (Q9ZLU5) CAG pathogenicity island protein 12 precursor | 28 | 7.4 | 3 | PPO_VICFA (Q06215) Polyphenol oxidase A1, chloroplast precursor ... | 27 | 9.7 |
|---|
>CAGT_HELPY (P97245) CAG pathogenicity island protein 12 precursor| Length = 280 Score = 27.7 bits (60), Expect = 7.4 Identities = 15/40 (37%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = +3 Query: 159 PFNYKIL-TPVQTKSTRPLQKCYLLPPRDIYLSLPLLHHS 275 P N K+ TP + P K YLL + + L+ L+HHS Sbjct: 51 PLNDKLKDTPFMVQVKLPNYKDYLLDNKQVVLTFKLVHHS 90
>CAGT_HELPJ (Q9ZLU5) CAG pathogenicity island protein 12 precursor| Length = 280 Score = 27.7 bits (60), Expect = 7.4 Identities = 15/40 (37%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = +3 Query: 159 PFNYKIL-TPVQTKSTRPLQKCYLLPPRDIYLSLPLLHHS 275 P N K+ TP + P K YLL + + L+ L+HHS Sbjct: 51 PLNDKLKDTPFMVQVKLPNYKDYLLDNKQVVLTFKLVHHS 90
>PPO_VICFA (Q06215) Polyphenol oxidase A1, chloroplast precursor (EC 1.10.3.1)| (PPO) (Catechol oxidase) Length = 606 Score = 27.3 bits (59), Expect = 9.7 Identities = 22/90 (24%), Positives = 40/90 (44%), Gaps = 5/90 (5%) Frame = +2 Query: 53 YLHIAKRHHCSQLKVNLRVPTCSAKRIGWSNNHNDTFQLQNLNTCTN*KH*APTEM---- 220 Y + K+H S+L+ R TCS+ +NN N+ + Q L+ + + Sbjct: 27 YPFLQKQHQSSKLRKPKRQVTCSS-----NNNQNNPKEEQELSNIVGHRRNVLIGLGGIY 81 Query: 221 -LFVTSPRYLSITAPITPFHEQNCVPSQEV 307 T+P ++ +PI+P CVP ++ Sbjct: 82 GTLATNPS--ALASPISPPDLSKCVPPSDL 109 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,395,078 Number of Sequences: 219361 Number of extensions: 845463 Number of successful extensions: 1783 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1750 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1783 length of database: 80,573,946 effective HSP length: 87 effective length of database: 61,489,539 effective search space used: 1475748936 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)