Clone Name | rbastl22h02 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | GLIS1_HUMAN (Q8NBF1) Zinc finger protein GLIS1 (GLI-similar 1) | 28 | 5.4 | 2 | NADA_CYAPA (P31179) Quinolinate synthetase A | 28 | 7.0 | 3 | RP1L1_HUMAN (Q8IWN7) Retinitis pigmentosa 1-like 1 protein | 27 | 9.2 |
---|
>GLIS1_HUMAN (Q8NBF1) Zinc finger protein GLIS1 (GLI-similar 1)| Length = 620 Score = 28.1 bits (61), Expect = 5.4 Identities = 14/35 (40%), Positives = 17/35 (48%) Frame = -1 Query: 359 SDAPAGCGVSNHLTPGLVSALTTYHSGHLTCSCLP 255 SD GCG+ L PG+ T H+G L LP Sbjct: 386 SDGKGGCGLGQELLPGVYPGSITPHNG-LASGLLP 419
>NADA_CYAPA (P31179) Quinolinate synthetase A| Length = 329 Score = 27.7 bits (60), Expect = 7.0 Identities = 13/45 (28%), Positives = 21/45 (46%) Frame = -1 Query: 356 DAPAGCGVSNHLTPGLVSALTTYHSGHLTCSCLPSSTHLVRQTDM 222 D AGC +++ P + S HS HL S + S + +D+ Sbjct: 101 DLNAGCSLADSCPPEIFSEFKKAHSDHLVISYINCSASIKAMSDI 145
>RP1L1_HUMAN (Q8IWN7) Retinitis pigmentosa 1-like 1 protein| Length = 2480 Score = 27.3 bits (59), Expect = 9.2 Identities = 13/21 (61%), Positives = 14/21 (66%) Frame = -1 Query: 356 DAPAGCGVSNHLTPGLVSALT 294 +APAGC VS PG VSA T Sbjct: 1063 EAPAGCRVSLRALPGRVSAST 1083 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,727,024 Number of Sequences: 219361 Number of extensions: 860336 Number of successful extensions: 1897 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1871 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1897 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 1396778976 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)