Clone Name | rbastl22g11 |
---|---|
Clone Library Name | barley_pub |
>VE2_HPV34 (P36792) Regulatory protein E2| Length = 345 Score = 29.3 bits (64), Expect = 2.6 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = -1 Query: 159 LLLDSLRSSNKSTLEWFLHTGSLIRWFGDLSSCF 58 L L+SL S+ +T EW L S +W D CF Sbjct: 78 LALESLNESSYNTEEWTLQQTSWEQWVTDPKQCF 111
>SUSY_BETVU (Q42652) Sucrose synthase (EC 2.4.1.13) (Sucrose-UDP| glucosyltransferase) (Fragment) Length = 766 Score = 29.3 bits (64), Expect = 2.6 Identities = 19/44 (43%), Positives = 23/44 (52%) Frame = -1 Query: 159 LLLDSLRSSNKSTLEWFLHTGSLIRWFGDLSSCFNHEMFSFHGY 28 LLLD L++ + STLE FL G L FN + S HGY Sbjct: 198 LLLDILQAPDPSTLETFL---------GRLPMVFNVVILSVHGY 232
>CFA_CITFR (P45509) Cyclopropane-fatty-acyl-phospholipid synthase (EC| 2.1.1.79) (Cyclopropane fatty acid synthase) (CFA synthase) (Fragment) Length = 89 Score = 28.9 bits (63), Expect = 3.4 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = -3 Query: 322 FMRIWEYYLIFSAACFKLRALGDYQVVFSR 233 F R++ YYL A F+ R + +QV+FSR Sbjct: 50 FRRMFNYYLCACAGAFRARDIELWQVLFSR 79
>CFA_ECOLI (P0A9H7) Cyclopropane-fatty-acyl-phospholipid synthase (EC| 2.1.1.79) (Cyclopropane fatty acid synthase) (CFA synthase) Length = 381 Score = 28.9 bits (63), Expect = 3.4 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = -3 Query: 322 FMRIWEYYLIFSAACFKLRALGDYQVVFSR 233 F R++ YYL A F+ R + +QVVFSR Sbjct: 342 FKRMFTYYLNACAGAFRARDIQLWQVVFSR 371
>CFA_ECOL6 (P0A9H8) Cyclopropane-fatty-acyl-phospholipid synthase (EC| 2.1.1.79) (Cyclopropane fatty acid synthase) (CFA synthase) Length = 381 Score = 28.9 bits (63), Expect = 3.4 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = -3 Query: 322 FMRIWEYYLIFSAACFKLRALGDYQVVFSR 233 F R++ YYL A F+ R + +QVVFSR Sbjct: 342 FKRMFTYYLNACAGAFRARDIQLWQVVFSR 371
>VE2_RHPV1 (P22156) Regulatory protein E2| Length = 366 Score = 28.5 bits (62), Expect = 4.4 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = -1 Query: 159 LLLDSLRSSNKSTLEWFLHTGSLIRWFGDLSSCF 58 L L+SL++S + EW L SL W + CF Sbjct: 78 LALESLQNSEYNNEEWTLQDASLEMWHTEPKGCF 111
>CSTF2_PONPY (Q5RDA3) Cleavage stimulation factor, 64 kDa subunit (CSTF 64 kDa| subunit) (CF-1 64 kDa subunit) (CstF-64) Length = 577 Score = 28.1 bits (61), Expect = 5.8 Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 4/34 (11%) Frame = +3 Query: 150 RAATILQLTGE----RYVAFSHQGRPSRRLPGRE 239 R T+L +TGE Y+ HQG P +PG E Sbjct: 330 RGGTLLSVTGEVEPRGYLGPPHQGPPMHHVPGHE 363
>CSTF2_HUMAN (P33240) Cleavage stimulation factor, 64 kDa subunit (CSTF 64 kDa| subunit) (CF-1 64 kDa subunit) (CstF-64) Length = 577 Score = 28.1 bits (61), Expect = 5.8 Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 4/34 (11%) Frame = +3 Query: 150 RAATILQLTGE----RYVAFSHQGRPSRRLPGRE 239 R T+L +TGE Y+ HQG P +PG E Sbjct: 330 RGGTLLSVTGEVEPRGYLGPPHQGPPMHHVPGHE 363
>PQQE_PSEF5 (Q4K4U8) Coenzyme PQQ synthesis protein E (Pyrroloquinoline quinone| biosynthesis protein E) Length = 389 Score = 28.1 bits (61), Expect = 5.8 Identities = 13/24 (54%), Positives = 15/24 (62%), Gaps = 2/24 (8%) Frame = -3 Query: 232 PGNRRLGLP*WLNA--TYRSPVSC 167 PG +GLP WL A TYR P+ C Sbjct: 15 PGKPEVGLPLWLLAELTYRCPLQC 38
>ACS2L_MOUSE (Q99NB1) Acetyl-coenzyme A synthetase 2-like, mitochondrial| precursor (EC 6.2.1.1) (Acetate--CoA ligase 2) (Acetyl-CoA synthetase 2) (AceCS2) (Acyl-CoA synthetase short-chain family member 1) Length = 682 Score = 27.7 bits (60), Expect = 7.5 Identities = 11/25 (44%), Positives = 18/25 (72%) Frame = -2 Query: 269 TSSWRLPGCFLSSRQPAARPALMAE 195 +++ RLPGC ++ QP + PAL A+ Sbjct: 33 STATRLPGCVPAAAQPGSYPALSAQ 57
>CYB_TRYBO (Q33568) Cytochrome b| Length = 372 Score = 27.3 bits (59), Expect = 9.8 Identities = 12/33 (36%), Positives = 21/33 (63%) Frame = -1 Query: 162 WLLLDSLRSSNKSTLEWFLHTGSLIRWFGDLSS 64 W+++D+L++S+K EWF + +FG L S Sbjct: 260 WIIVDTLKTSDKILPEWF-----FLSFFGFLKS 287 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,301,173 Number of Sequences: 219361 Number of extensions: 828025 Number of successful extensions: 1804 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 1781 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1804 length of database: 80,573,946 effective HSP length: 83 effective length of database: 62,366,983 effective search space used: 1496807592 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)