Clone Name | rbastl22e09 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | TRUD_LEGPL (Q5WWQ2) tRNA pseudouridine synthase D (EC 5.4.99.-) ... | 30 | 1.9 | 2 | TRUD_LEGPH (Q5ZV19) tRNA pseudouridine synthase D (EC 5.4.99.-) ... | 29 | 3.3 | 3 | TRUD_LEGPA (Q5X4T2) tRNA pseudouridine synthase D (EC 5.4.99.-) ... | 29 | 3.3 | 4 | DTX_DROME (Q23985) Protein deltex | 28 | 7.3 | 5 | GRAK_RAT (P49864) Granzyme K precursor (EC 3.4.21.-) (NK-tryptas... | 27 | 9.5 |
---|
>TRUD_LEGPL (Q5WWQ2) tRNA pseudouridine synthase D (EC 5.4.99.-) (tRNA-uridine| isomerase D) (tRNA pseudouridylate synthase D) Length = 338 Score = 29.6 bits (65), Expect = 1.9 Identities = 14/32 (43%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Frame = +2 Query: 62 HAPGTT--GIYSLQSPGWEYINRKRHIKYTFP 151 HAPG GI +L++PGW+ + RH K P Sbjct: 91 HAPGEVIEGIETLEAPGWKILECTRHNKKLRP 122
>TRUD_LEGPH (Q5ZV19) tRNA pseudouridine synthase D (EC 5.4.99.-) (tRNA-uridine| isomerase D) (tRNA pseudouridylate synthase D) Length = 338 Score = 28.9 bits (63), Expect = 3.3 Identities = 14/32 (43%), Positives = 18/32 (56%), Gaps = 2/32 (6%) Frame = +2 Query: 62 HAPGTT--GIYSLQSPGWEYINRKRHIKYTFP 151 HAPG GI +L++PGW + RH K P Sbjct: 91 HAPGEIIDGIETLEAPGWRILECTRHNKKLKP 122
>TRUD_LEGPA (Q5X4T2) tRNA pseudouridine synthase D (EC 5.4.99.-) (tRNA-uridine| isomerase D) (tRNA pseudouridylate synthase D) Length = 338 Score = 28.9 bits (63), Expect = 3.3 Identities = 14/32 (43%), Positives = 18/32 (56%), Gaps = 2/32 (6%) Frame = +2 Query: 62 HAPGTT--GIYSLQSPGWEYINRKRHIKYTFP 151 HAPG GI +L++PGW + RH K P Sbjct: 91 HAPGEIIDGIETLEAPGWRILECTRHNKKLKP 122
>DTX_DROME (Q23985) Protein deltex| Length = 738 Score = 27.7 bits (60), Expect = 7.3 Identities = 19/68 (27%), Positives = 27/68 (39%) Frame = +3 Query: 45 FSSELNMLPAQQASTHSRVQDGSISIANGT*NIHFXXXXXXXXXXXXXXXTYTVNSRTHH 224 FS NML A S HSR +GS+ + T T + ++H Sbjct: 367 FSHAKNMLTASMNSHHSRCSEGSLQSQRSS-----RMGSHRSRSRTRTSDTDTNSVKSHR 421 Query: 225 RRPLLRSV 248 RRP + +V Sbjct: 422 RRPSVDTV 429
>GRAK_RAT (P49864) Granzyme K precursor (EC 3.4.21.-) (NK-tryptase-2)| (NK-Tryp-2) Length = 258 Score = 27.3 bits (59), Expect = 9.5 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +1 Query: 175 HSLNPHQPTPSTLELITVVPFSGRLFTAGEKSTETVK 285 HSL+ ++P T E+ +PFSG F +G +K Sbjct: 81 HSLSKNEPMKQTFEIKEFIPFSG--FKSGTNDIMLIK 115 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,928,423 Number of Sequences: 219361 Number of extensions: 753332 Number of successful extensions: 1800 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1787 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1800 length of database: 80,573,946 effective HSP length: 91 effective length of database: 60,612,095 effective search space used: 1454690280 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)