| Clone Name | rbastl22e08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | LEUNG_ARATH (Q9FUY2) Transcriptional corepressor LEUNIG | 31 | 0.84 | 2 | VG59_EHV1V (P84447) Hypothetical gene 59 protein | 30 | 1.4 | 3 | VG59_EHV1B (P28983) Hypothetical gene 59 protein | 30 | 1.4 | 4 | USP_DROME (P20153) Protein ultraspiracle (XR2C) (Chorion factor 1) | 27 | 9.3 | 5 | NIR_ALCFA (P38501) Copper-containing nitrite reductase precursor... | 27 | 9.3 |
|---|
>LEUNG_ARATH (Q9FUY2) Transcriptional corepressor LEUNIG| Length = 931 Score = 30.8 bits (68), Expect = 0.84 Identities = 20/61 (32%), Positives = 30/61 (49%), Gaps = 5/61 (8%) Frame = +2 Query: 5 QQSQEQLKKSKAQDRPPSRSQGH*KTKQ-----VSTQLYKRRDGSMVGSVDAGYNVATRE 169 QQ Q+Q ++ + Q++PPS+ Q T Q Q +RRDGS + + A V Sbjct: 145 QQQQQQQQQQQHQNQPPSQQQQQQSTPQHQQQPTPQQQPQRRDGSHLANGSANGLVGNNS 204 Query: 170 E 172 E Sbjct: 205 E 205
>VG59_EHV1V (P84447) Hypothetical gene 59 protein| Length = 179 Score = 30.0 bits (66), Expect = 1.4 Identities = 22/67 (32%), Positives = 28/67 (41%), Gaps = 6/67 (8%) Frame = +1 Query: 184 VGSVDAGYNVAMGKHIRSS*NCLRGQIRSPHSAECQEQHG------DHADEXXXXXXXXX 345 +G D N AMG +RSS RG +R+P E Q Q G +HA Sbjct: 101 IGRPDTPVNAAMGSALRSS-QRPRGDVRNPR-GEGQTQRGGSRGEANHAQRRQSVTQSTA 158 Query: 346 XXXTQPY 366 TQP+ Sbjct: 159 ARQTQPH 165
>VG59_EHV1B (P28983) Hypothetical gene 59 protein| Length = 179 Score = 30.0 bits (66), Expect = 1.4 Identities = 22/67 (32%), Positives = 28/67 (41%), Gaps = 6/67 (8%) Frame = +1 Query: 184 VGSVDAGYNVAMGKHIRSS*NCLRGQIRSPHSAECQEQHG------DHADEXXXXXXXXX 345 +G D N AMG +RSS RG +R+P E Q Q G +HA Sbjct: 101 IGRPDTPVNAAMGSALRSS-QRPRGDVRNPR-GEGQTQRGGSRGEANHAQRRQSVTQSTA 158 Query: 346 XXXTQPY 366 TQP+ Sbjct: 159 ARQTQPH 165
>USP_DROME (P20153) Protein ultraspiracle (XR2C) (Chorion factor 1)| Length = 508 Score = 27.3 bits (59), Expect = 9.3 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +2 Query: 233 GPLETVSVDKYGALTLQSAKSNTEIMLMNFHGALLPHFFQ 352 GP TV D GA++ N ++ M + ++PHF Q Sbjct: 265 GPYSTVQPDYKGAVSALCQVVNKQLFQMVEYARMMPHFAQ 304
>NIR_ALCFA (P38501) Copper-containing nitrite reductase precursor (EC 1.7.2.1)| (Cu-NIR) Length = 376 Score = 27.3 bits (59), Expect = 9.3 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = +2 Query: 233 GPLETVSVDKYGALTLQSAKSNTEIMLMNFHGA 331 GPL V D Y LTL + ++NT + ++FH A Sbjct: 106 GPLMVVHQDDYLELTLINPETNTLMHNIDFHAA 138 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,547,693 Number of Sequences: 219361 Number of extensions: 965819 Number of successful extensions: 2311 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2204 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2310 length of database: 80,573,946 effective HSP length: 99 effective length of database: 58,857,207 effective search space used: 1412572968 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)