Clone Name | rbastl22e02 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | ISPE_CHLCV (Q821X0) 4-diphosphocytidyl-2-C-methyl-D-erythritol k... | 29 | 2.9 | 2 | CCNB3_MOUSE (Q810T2) G2/mitotic-specific cyclin-B3 | 29 | 2.9 | 3 | TILS_BUCBP (Q89AX3) tRNA(Ile)-lysidine synthase (EC 6.3.4.-) (tR... | 29 | 3.8 | 4 | NAD2_CAEEL (P32739) Sodium-dependent high-affinity dicarboxylate... | 28 | 6.4 |
---|
>ISPE_CHLCV (Q821X0) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC| 2.7.1.148) (CMK) (4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol kinase) Length = 291 Score = 29.3 bits (64), Expect = 2.9 Identities = 15/45 (33%), Positives = 21/45 (46%), Gaps = 6/45 (13%) Frame = +3 Query: 45 NADTIYCNRQNTPKPQYIVTNCVRTEKNY*H------WRRHKNIP 161 N DT+ CN PQ +V ++ ++Y WR HK IP Sbjct: 45 NEDTLICNLPELSTPQNLVWKSLQIFRDYTQVNDPVAWRLHKRIP 89
>CCNB3_MOUSE (Q810T2) G2/mitotic-specific cyclin-B3| Length = 1396 Score = 29.3 bits (64), Expect = 2.9 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = -1 Query: 117 FLHNL*QCTVVLEYSVGYNISCQHCRSRKLN 25 ++ NL C LEY GY ++ H RKLN Sbjct: 1319 YMRNLSNCVPTLEYFTGYKMAELHILVRKLN 1349
>TILS_BUCBP (Q89AX3) tRNA(Ile)-lysidine synthase (EC 6.3.4.-)| (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) Length = 438 Score = 28.9 bits (63), Expect = 3.8 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = +2 Query: 5 ISQNNLKFSFRLLQC*HDIL*PTEYSKTTVHCYKLCKN 118 + +NNL F+FR + H + +E K + HC K+C N Sbjct: 34 LKKNNLNFTFRAIHINHQLHPDSE--KWSDHCKKICIN 69
>NAD2_CAEEL (P32739) Sodium-dependent high-affinity dicarboxylate transporter 2| (Na(+)/dicarboxylate cotransporter 2) (NaDC-2) (ceNaDC2) Length = 551 Score = 28.1 bits (61), Expect = 6.4 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = -2 Query: 191 QGXXXXFSVKWDVFVSPPMLIILFSSYTI 105 +G ++W VF PPM + L +SY I Sbjct: 233 EGQVTMTYLQWMVFAIPPMFVYLLASYII 261 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29,530,644 Number of Sequences: 219361 Number of extensions: 453859 Number of successful extensions: 1071 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1063 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1070 length of database: 80,573,946 effective HSP length: 50 effective length of database: 69,605,896 effective search space used: 1670541504 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)