Clone Name | rbastl22c07 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | PWP1_YEAST (P21304) Periodic tryptophan protein 1 | 30 | 1.3 |
---|
>PWP1_YEAST (P21304) Periodic tryptophan protein 1| Length = 576 Score = 30.4 bits (67), Expect = 1.3 Identities = 14/47 (29%), Positives = 25/47 (53%) Frame = -3 Query: 234 TSIVKSHHPMVYTQVRHEEYTRPLIYSCSVIHVGRLLNVSAPNPARS 94 T + +HH + H +Y R ++ S S H +L ++++ N ARS Sbjct: 278 TGHITTHHTDAVLSMAHNKYFRSVLASTSADHTVKLWDLNSGNAARS 324 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,967,986 Number of Sequences: 219361 Number of extensions: 539094 Number of successful extensions: 1365 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1350 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1365 length of database: 80,573,946 effective HSP length: 56 effective length of database: 68,289,730 effective search space used: 1638953520 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)