ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbastl22b12 |
|---|---|
| Clone Library Name | barley_pub |
>LOX1_HORVU (P29114) Lipoxygenase 1 (EC 1.13.11.12)| Length = 862 Score = 68.6 bits (166), Expect = 4e-12 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = -3 Query: 372 RTGPAKFPYMLLYPNTSDHTGQAEGLSARGIPNSISI 262 R GPAKFPYMLLYPNTSDH G A GL+A+GIPNSISI Sbjct: 826 RNGPAKFPYMLLYPNTSDHKGAAAGLTAKGIPNSISI 862
>LOX3_ORYSA (Q7G794) Putative lipoxygenase 3 (EC 1.13.11.12)| Length = 866 Score = 64.3 bits (155), Expect = 7e-11 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = -3 Query: 372 RTGPAKFPYMLLYPNTSDHTGQAEGLSARGIPNSISI 262 R GPA+FPYMLLYPNTSD TG A G++A+GIPNSISI Sbjct: 830 RNGPAEFPYMLLYPNTSDVTGAAAGITAKGIPNSISI 866
>LOX1_ORYSA (Q76I22) Lipoxygenase 1 (EC 1.13.11.12) (9-lipoxygenase) (r9-LOX1)| Length = 863 Score = 62.0 bits (149), Expect = 3e-10 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -3 Query: 372 RTGPAKFPYMLLYPNTSDHTGQAEGLSARGIPNSISI 262 R GPA FPY L++PNTSD+ G AEG++ARGIPNSISI Sbjct: 827 RVGPANFPYTLMFPNTSDNKGAAEGITARGIPNSISI 863
>LOX2_ORYSA (P29250) Lipoxygenase 2 (EC 1.13.11.12) (Lipoxygenase L-2)| Length = 870 Score = 61.2 bits (147), Expect = 6e-10 Identities = 29/37 (78%), Positives = 29/37 (78%) Frame = -3 Query: 372 RTGPAKFPYMLLYPNTSDHTGQAEGLSARGIPNSISI 262 R GP FPY LLYPNTSD G A GLSARGIPNSISI Sbjct: 834 RVGPTNFPYTLLYPNTSDLKGDAAGLSARGIPNSISI 870
>LOX4_ORYSA (Q53RB0) Probable lipoxygenase 4 (EC 1.13.11.12)| Length = 877 Score = 54.7 bits (130), Expect = 5e-08 Identities = 27/38 (71%), Positives = 30/38 (78%), Gaps = 1/38 (2%) Frame = -3 Query: 372 RTGPAKFPYMLLYPNTSDHTGQ-AEGLSARGIPNSISI 262 R GP K PYMLLYPNTSD T + +GL+A GIPNSISI Sbjct: 840 RNGPVKMPYMLLYPNTSDVTKEKGQGLTAMGIPNSISI 877
>LOX4_SOYBN (P38417) Lipoxygenase-4 (EC 1.13.11.12) (L-4) (VSP94)| Length = 853 Score = 44.3 bits (103), Expect = 7e-05 Identities = 23/37 (62%), Positives = 26/37 (70%) Frame = -3 Query: 372 RTGPAKFPYMLLYPNTSDHTGQAEGLSARGIPNSISI 262 R GPAK PY LLYP++ EGL+ RGIPNSISI Sbjct: 823 RYGPAKMPYTLLYPSSE------EGLTFRGIPNSISI 853
>LOX1_LENCU (P38414) Lipoxygenase (EC 1.13.11.12)| Length = 866 Score = 43.5 bits (101), Expect = 1e-04 Identities = 22/37 (59%), Positives = 25/37 (67%) Frame = -3 Query: 372 RTGPAKFPYMLLYPNTSDHTGQAEGLSARGIPNSISI 262 R GP K PY LLYP++ EGL+ RGIPNSISI Sbjct: 836 RYGPVKMPYTLLYPSSE------EGLTCRGIPNSISI 866
>LOX2_SOYBN (P09439) Seed lipoxygenase-2 (EC 1.13.11.12) (L-2)| Length = 865 Score = 42.0 bits (97), Expect = 4e-04 Identities = 21/37 (56%), Positives = 25/37 (67%) Frame = -3 Query: 372 RTGPAKFPYMLLYPNTSDHTGQAEGLSARGIPNSISI 262 R GP + PY LL+PN+ EGL+ RGIPNSISI Sbjct: 836 RLGPVQLPYTLLHPNS-------EGLTCRGIPNSISI 865
>LOX1_SOYBN (P08170) Seed lipoxygenase-1 (EC 1.13.11.12) (L-1)| Length = 839 Score = 41.6 bits (96), Expect = 5e-04 Identities = 21/37 (56%), Positives = 25/37 (67%) Frame = -3 Query: 372 RTGPAKFPYMLLYPNTSDHTGQAEGLSARGIPNSISI 262 R GP + PY LLYP++ EGL+ RGIPNSISI Sbjct: 809 RLGPVQLPYTLLYPSSE------EGLTFRGIPNSISI 839
>LOX3_PEA (P09918) Seed lipoxygenase-3 (EC 1.13.11.12)| Length = 861 Score = 41.2 bits (95), Expect = 6e-04 Identities = 21/37 (56%), Positives = 25/37 (67%) Frame = -3 Query: 372 RTGPAKFPYMLLYPNTSDHTGQAEGLSARGIPNSISI 262 R GP + PY LLYP++ EGL+ RGIPNSISI Sbjct: 831 RHGPVEMPYTLLYPSSK------EGLTFRGIPNSISI 861
>LOXA_PHAVU (P27480) Lipoxygenase 1 (EC 1.13.11.12)| Length = 862 Score = 40.8 bits (94), Expect = 8e-04 Identities = 21/37 (56%), Positives = 23/37 (62%) Frame = -3 Query: 372 RTGPAKFPYMLLYPNTSDHTGQAEGLSARGIPNSISI 262 R GP K PY +L P D EGL+ RGIPNSISI Sbjct: 831 RNGPVKMPYTVLLPTCED-----EGLTFRGIPNSISI 862
>LOX2_PEA (P14856) Seed lipoxygenase-2 (EC 1.13.11.12)| Length = 864 Score = 40.0 bits (92), Expect = 0.001 Identities = 20/37 (54%), Positives = 25/37 (67%) Frame = -3 Query: 372 RTGPAKFPYMLLYPNTSDHTGQAEGLSARGIPNSISI 262 R GP + PY LL+P++ EGL+ RGIPNSISI Sbjct: 834 RVGPVQLPYTLLHPSSK------EGLTFRGIPNSISI 864
>LOXX_SOYBN (P24095) Seed lipoxygenase (EC 1.13.11.12)| Length = 864 Score = 38.9 bits (89), Expect = 0.003 Identities = 20/37 (54%), Positives = 23/37 (62%) Frame = -3 Query: 372 RTGPAKFPYMLLYPNTSDHTGQAEGLSARGIPNSISI 262 RTGP + PY LL H EGL+ +GIPNSISI Sbjct: 834 RTGPVQLPYTLL------HRSSEEGLTFKGIPNSISI 864
>LOXB_LYCES (P38416) Lipoxygenase B (EC 1.13.11.12)| Length = 859 Score = 38.9 bits (89), Expect = 0.003 Identities = 18/37 (48%), Positives = 24/37 (64%) Frame = -3 Query: 372 RTGPAKFPYMLLYPNTSDHTGQAEGLSARGIPNSISI 262 R+GP PY LL+P + EGL+ +GIPNS+SI Sbjct: 829 RSGPVNVPYTLLFPTSE------EGLTGKGIPNSVSI 859
>LOX3_SOYBN (P09186) Seed lipoxygenase-3 (EC 1.13.11.12) (L-3)| Length = 857 Score = 38.5 bits (88), Expect = 0.004 Identities = 20/37 (54%), Positives = 24/37 (64%) Frame = -3 Query: 372 RTGPAKFPYMLLYPNTSDHTGQAEGLSARGIPNSISI 262 R GP + PY LL P++ EGL+ RGIPNSISI Sbjct: 827 RCGPVQMPYTLLLPSSK------EGLTFRGIPNSISI 857
>LOXA_LYCES (P38415) Lipoxygenase A (EC 1.13.11.12)| Length = 860 Score = 37.7 bits (86), Expect = 0.007 Identities = 18/37 (48%), Positives = 23/37 (62%) Frame = -3 Query: 372 RTGPAKFPYMLLYPNTSDHTGQAEGLSARGIPNSISI 262 RTGP PY LL+P + GL+ +GIPNS+SI Sbjct: 830 RTGPVNAPYTLLFPTSEG------GLTGKGIPNSVSI 860
>LOX1_ARATH (Q06327) Lipoxygenase 1 (EC 1.13.11.12)| Length = 859 Score = 37.0 bits (84), Expect = 0.012 Identities = 18/37 (48%), Positives = 24/37 (64%) Frame = -3 Query: 372 RTGPAKFPYMLLYPNTSDHTGQAEGLSARGIPNSISI 262 RTG K PY LL+P++ G++ RGIPNS+SI Sbjct: 829 RTGLVKMPYTLLFPSSEG------GVTGRGIPNSVSI 859
>LOX1_SOLTU (P37831) Lipoxygenase 1 (EC 1.13.11.12)| Length = 861 Score = 36.2 bits (82), Expect = 0.020 Identities = 17/37 (45%), Positives = 23/37 (62%) Frame = -3 Query: 372 RTGPAKFPYMLLYPNTSDHTGQAEGLSARGIPNSISI 262 R+GP PY LL+P + GL+ +GIPNS+SI Sbjct: 831 RSGPVNAPYTLLFPTSEG------GLTGKGIPNSVSI 861
>LOXB_PHAVU (P27481) Lipoxygenase (EC 1.13.11.12) (Fragment)| Length = 741 Score = 35.8 bits (81), Expect = 0.026 Identities = 18/31 (58%), Positives = 21/31 (67%) Frame = -3 Query: 372 RTGPAKFPYMLLYPNTSDHTGQAEGLSARGI 280 RTGPAK PY LLYP++ EGL+ RGI Sbjct: 717 RTGPAKMPYTLLYPSSE------EGLTFRGI 741
>LOX6_ORYSA (Q8H016) Probable lipoxygenase 6 (EC 1.13.11.12)| Length = 918 Score = 30.0 bits (66), Expect = 1.4 Identities = 16/37 (43%), Positives = 21/37 (56%) Frame = -3 Query: 372 RTGPAKFPYMLLYPNTSDHTGQAEGLSARGIPNSISI 262 R G PY LL P++ G++ RG+PNSISI Sbjct: 888 RCGAGVLPYELLAPSSPP------GVTCRGVPNSISI 918
>FOXJ3_MOUSE (Q8BUR3) Forkhead box protein J3| Length = 623 Score = 28.9 bits (63), Expect = 3.2 Identities = 15/41 (36%), Positives = 18/41 (43%), Gaps = 5/41 (12%) Frame = -2 Query: 373 PHRAGQVPIHAALPKHLRPHGTGRGALRQGH-----PEQHI 266 PHR +P H P+H PH L+ H P QHI Sbjct: 385 PHRPHGLPQHPQRPQHPAPHPQQHSQLQPPHSQHPPPHQHI 425
>NOTC2_MOUSE (O35516) Neurogenic locus notch homolog protein 2 precursor (Notch| 2) (Motch B) [Contains: Notch 2 extracellular truncation; Notch 2 intracellular domain] Length = 2470 Score = 28.9 bits (63), Expect = 3.2 Identities = 16/53 (30%), Positives = 25/53 (47%), Gaps = 7/53 (13%) Frame = -3 Query: 189 CVCV-------CDKELCRCMNN*GNEGACTTGLIGMRKLSSAGYRSMHRRVQK 52 C+C C ++ C++N G CT GL G + L AG+ ++ V K Sbjct: 704 CICPEGPHHPSCYSQVNECLSNPCIHGNCTGGLSGYKCLCDAGWVGVNCEVDK 756
>NOTC2_HUMAN (Q04721) Neurogenic locus notch homolog protein 2 precursor (Notch| 2) (hN2) [Contains: Notch 2 extracellular truncation; Notch 2 intracellular domain] Length = 2471 Score = 28.9 bits (63), Expect = 3.2 Identities = 16/53 (30%), Positives = 25/53 (47%), Gaps = 7/53 (13%) Frame = -3 Query: 189 CVCV-------CDKELCRCMNN*GNEGACTTGLIGMRKLSSAGYRSMHRRVQK 52 C+C C ++ C++N G CT GL G + L AG+ ++ V K Sbjct: 706 CICPEGPHHPSCYSQVNECLSNPCIHGNCTGGLSGYKCLCDAGWVGINCEVDK 758
>ACV1C_HUMAN (Q8NER5) Activin receptor type 1C precursor (EC 2.7.11.30)| (ACTR-IC) (Activin receptor-like kinase 7) (ALK-7) Length = 493 Score = 28.9 bits (63), Expect = 3.2 Identities = 17/41 (41%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -3 Query: 243 RRDLMLLCYPCLLTPELACVC-VCDKELCRCMNN*GNEGAC 124 R+ L+LL L+P L CVC +CD C EGAC Sbjct: 10 RQALLLLAAAAELSPGLKCVCLLCDSSNFTCQ----TEGAC 46
>ALR1_SALTY (P0A1A3) Alanine racemase, biosynthetic (EC 5.1.1.1)| Length = 359 Score = 28.5 bits (62), Expect = 4.1 Identities = 16/36 (44%), Positives = 19/36 (52%) Frame = +1 Query: 253 LRSNGYAVRDAPGGEPLGLSRVVGGVWVEQHVWELG 360 L S+ AVRD GEP+G GG WV + LG Sbjct: 237 LTSSLIAVRDHKAGEPVG----YGGTWVSERDTRLG 268
>ALR1_SALTI (P0A1A4) Alanine racemase, biosynthetic (EC 5.1.1.1)| Length = 359 Score = 28.5 bits (62), Expect = 4.1 Identities = 16/36 (44%), Positives = 19/36 (52%) Frame = +1 Query: 253 LRSNGYAVRDAPGGEPLGLSRVVGGVWVEQHVWELG 360 L S+ AVRD GEP+G GG WV + LG Sbjct: 237 LTSSLIAVRDHKAGEPVG----YGGTWVSERDTRLG 268
>LOX5_ORYSA (Q7XV13) Putative lipoxygenase 5 (EC 1.13.11.12)| Length = 899 Score = 28.5 bits (62), Expect = 4.1 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = -3 Query: 372 RTGPAKFPYMLLYPNTSDHTGQAEGLSARGIPNSISI 262 R G PY L+ P++ G++ RG+PNS++I Sbjct: 869 RCGAGVLPYELMAPSSGP------GITCRGVPNSVTI 899
>LOX23_HORVU (Q8GSM2) Lipoxygenase 2.3, chloroplast precursor (EC 1.13.11.12)| (LOX2:Hv:3) Length = 896 Score = 28.5 bits (62), Expect = 4.1 Identities = 17/37 (45%), Positives = 20/37 (54%) Frame = -3 Query: 372 RTGPAKFPYMLLYPNTSDHTGQAEGLSARGIPNSISI 262 R G PY LL P + G++ RGIPNSISI Sbjct: 866 RCGAGIVPYELLKPFSEP------GVTGRGIPNSISI 896
>FRIZ3_DROME (O77438) Protein frizzled-3 precursor (dFz3)| Length = 581 Score = 28.5 bits (62), Expect = 4.1 Identities = 24/72 (33%), Positives = 30/72 (41%), Gaps = 5/72 (6%) Frame = -3 Query: 345 MLLYPNTSDHTGQ--AEGLSARGIPNSISI*SEHVRR---RDLMLLCYPCLLTPELACVC 181 M PN + HT Q AE A+ +P S S R L LC P + P AC Sbjct: 55 MTALPNLAGHTNQLEAELQIAKLVPLIESGCSRRARFLLCSSLFPLCTPDVPRPVAACKL 114 Query: 180 VCDKELCRCMNN 145 +C+ CM N Sbjct: 115 LCETVRGECMEN 126
>CB024_HUMAN (Q9BV87) Protein C2orf24| Length = 410 Score = 27.7 bits (60), Expect = 7.1 Identities = 18/65 (27%), Positives = 30/65 (46%), Gaps = 5/65 (7%) Frame = -3 Query: 273 SISI*SEHVRRRDLMLLCYPCLLTPELACVCVCDKELC-----RCMNN*GNEGACTTGLI 109 ++++ S V + L L C P P+L C E C +C+ + N +C G + Sbjct: 244 ALAVASVAVIHQSLGLSCTPTPGPPDLGLTSRCLLEPCIPSVPQCLPSPANVSSCLEGSM 303 Query: 108 GMRKL 94 G+R L Sbjct: 304 GLRSL 308
>THII_HALSA (Q9HQ72) Probable thiamine biosynthesis protein thiI| Length = 392 Score = 27.3 bits (59), Expect = 9.2 Identities = 16/37 (43%), Positives = 19/37 (51%), Gaps = 5/37 (13%) Frame = +1 Query: 277 RDAPGGEPLG-----LSRVVGGVWVEQHVWELGRPGA 372 RD PGG PLG ++ V GG+ WE R GA Sbjct: 170 RDGPGGMPLGTQQPLVALVSGGIDSPVAAWESMRRGA 206
>ITR1_ASCSU (P19398) Trypsin inhibitor (ATI)| Length = 62 Score = 27.3 bits (59), Expect = 9.2 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +3 Query: 261 KWICCSGCPWRRAPRPVPCGRRC 329 +W C GC A + VPC R C Sbjct: 11 QWTKCGGCEGTCAQKIVPCTREC 33 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,505,092 Number of Sequences: 219361 Number of extensions: 1193947 Number of successful extensions: 3225 Number of sequences better than 10.0: 32 Number of HSP's better than 10.0 without gapping: 3111 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3206 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 1407308304 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
