Clone Name | rbastl22b09 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | PAC11_YEAST (P40960) Protein PAC11 | 29 | 3.2 | 2 | GRPE_MYCCA (P71499) Protein grpE (HSP-70 cofactor) | 29 | 3.2 | 3 | S27A2_HUMAN (O14975) Very-long-chain acyl-CoA synthetase (EC 6.2... | 26 | 3.3 |
---|
>PAC11_YEAST (P40960) Protein PAC11| Length = 533 Score = 28.9 bits (63), Expect = 3.2 Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = -1 Query: 278 PVPYRPL-RVEFDLCTQERRM*QV*SCDEIGLAYLCVPPEDYSFV 147 PVP L +E D CT R+ ++ DE+G+A + ED +V Sbjct: 354 PVPLSQLLSLENDTCTYTERLQRLAKFDEVGIACMAYTSEDPQYV 398
>GRPE_MYCCA (P71499) Protein grpE (HSP-70 cofactor)| Length = 206 Score = 28.9 bits (63), Expect = 3.2 Identities = 9/26 (34%), Positives = 17/26 (65%) Frame = +2 Query: 125 NSTTIRNQQNYNLLVAHINRLIRSHH 202 N +RN + + ++V+ IN ++ SHH Sbjct: 118 NEVVLRNVKGFEMIVSQINNVLESHH 143
>S27A2_HUMAN (O14975) Very-long-chain acyl-CoA synthetase (EC 6.2.1.-) (VLCS)| (Very-long-chain-fatty-acid-CoA ligase) (VLACS) (THCA-CoA ligase) (Fatty-acid-coenzyme A ligase, very long-chain 1) (Long-chain-fatty-acid--CoA ligase) (EC 6.2.1.3) (Fatty acid Length = 620 Score = 25.8 bits (55), Expect(2) = 3.3 Identities = 15/45 (33%), Positives = 23/45 (51%), Gaps = 3/45 (6%) Frame = +2 Query: 155 YNLLVAHINRLIRSHHKTKPATFF---FLGYISRTPHAKVYMVQD 280 Y L VA + R +RS+ + +PA FL +TPH + +D Sbjct: 32 YFLKVAAVGRRVRSYGQRRPARTILRAFLEKARQTPHKPFLLFRD 76 Score = 21.6 bits (44), Expect(2) = 3.3 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = +3 Query: 45 PYYISDIGYCISAA 86 PY+ DIGY + A Sbjct: 24 PYFFQDIGYFLKVA 37 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,975,193 Number of Sequences: 219361 Number of extensions: 989210 Number of successful extensions: 2204 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2173 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2204 length of database: 80,573,946 effective HSP length: 94 effective length of database: 59,954,012 effective search space used: 1438896288 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)