| Clone Name | rbastl22b08 |
|---|---|
| Clone Library Name | barley_pub |
>AP1B1_MOUSE (O35643) AP-1 complex subunit beta-1 (Adapter-related protein complex| 1 beta-1 subunit) (Beta-adaptin 1) (Adaptor protein complex AP-1 beta-1 subunit) (Golgi adaptor HA1/AP1 adaptin beta subunit) (Clathrin assembly protein complex 1 beta larg Length = 943 Score = 42.4 bits (98), Expect = 5e-04 Identities = 24/69 (34%), Positives = 36/69 (52%) Frame = -3 Query: 436 LAASNVFFIAKRRNANMDVLYLSAKIPRGIPFLIELTAAVGAPGAKCAVKTPNREFVPLF 257 L +SN+F +AKR D+LY S K+ GI L EL G P ++K E Sbjct: 874 LQSSNIFTVAKRNVEGQDMLYQSLKLTNGIWVLAELRIQPGNPSFTLSLKCRAPEVSQHV 933 Query: 256 FEAMESLIK 230 ++A E+++K Sbjct: 934 YQAYETILK 942
>AP1B1_RAT (P52303) AP-1 complex subunit beta-1 (Adapter-related protein complex| 1 beta-1 subunit) (Beta-adaptin 1) (Adaptor protein complex AP-1 beta-1 subunit) (Golgi adaptor HA1/AP1 adaptin beta subunit) (Clathrin assembly protein complex 1 beta large Length = 949 Score = 40.0 bits (92), Expect = 0.003 Identities = 24/69 (34%), Positives = 35/69 (50%) Frame = -3 Query: 436 LAASNVFFIAKRRNANMDVLYLSAKIPRGIPFLIELTAAVGAPGAKCAVKTPNREFVPLF 257 L +SN+F +AKR D+LY S K+ GI L EL G P ++K E Sbjct: 880 LQSSNIFTVAKRTVEGQDMLYQSLKLTNGIWVLAELRIQPGNPSFTLSLKCRAPEVSQHD 939 Query: 256 FEAMESLIK 230 +A E+++K Sbjct: 940 IQAYETILK 948
>AP2B1_RAT (P62944) AP-2 complex subunit beta-1 (Adapter-related protein complex| 2 beta-1 subunit) (Beta-adaptin) (Plasma membrane adaptor HA2/AP2 adaptin beta subunit) (Clathrin assembly protein complex 2 beta large chain) (AP105B) Length = 937 Score = 39.7 bits (91), Expect = 0.003 Identities = 23/69 (33%), Positives = 34/69 (49%) Frame = -3 Query: 436 LAASNVFFIAKRRNANMDVLYLSAKIPRGIPFLIELTAAVGAPGAKCAVKTPNREFVPLF 257 L +NV+ IAKR D+LY S K+ GI L EL G P ++K E Sbjct: 868 LQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYI 927 Query: 256 FEAMESLIK 230 ++ +S++K Sbjct: 928 YQVYDSILK 936
>AP2B1_MOUSE (Q9DBG3) AP-2 complex subunit beta-1 (Adapter-related protein complex| 2 beta-1 subunit) (Beta-adaptin) (Plasma membrane adaptor HA2/AP2 adaptin beta subunit) (Clathrin assembly protein complex 2 beta large chain) (AP105B) Length = 937 Score = 39.7 bits (91), Expect = 0.003 Identities = 23/69 (33%), Positives = 34/69 (49%) Frame = -3 Query: 436 LAASNVFFIAKRRNANMDVLYLSAKIPRGIPFLIELTAAVGAPGAKCAVKTPNREFVPLF 257 L +NV+ IAKR D+LY S K+ GI L EL G P ++K E Sbjct: 868 LQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYI 927 Query: 256 FEAMESLIK 230 ++ +S++K Sbjct: 928 YQVYDSILK 936
>AP2B1_HUMAN (P63010) AP-2 complex subunit beta-1 (Adapter-related protein complex| 2 beta-1 subunit) (Beta-adaptin) (Plasma membrane adaptor HA2/AP2 adaptin beta subunit) (Clathrin assembly protein complex 2 beta large chain) (AP105B) Length = 937 Score = 39.7 bits (91), Expect = 0.003 Identities = 23/69 (33%), Positives = 34/69 (49%) Frame = -3 Query: 436 LAASNVFFIAKRRNANMDVLYLSAKIPRGIPFLIELTAAVGAPGAKCAVKTPNREFVPLF 257 L +NV+ IAKR D+LY S K+ GI L EL G P ++K E Sbjct: 868 LQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYI 927 Query: 256 FEAMESLIK 230 ++ +S++K Sbjct: 928 YQVYDSILK 936
>MLL3_MOUSE (Q8BRH4) Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog| (Histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3) (EC 2.1.1.43) Length = 4903 Score = 39.3 bits (90), Expect = 0.004 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -2 Query: 368 CEDPPWDSIPDRAYCCRWCSWCKVCSEDS 282 C DPP ++P + C+WC WC+ C S Sbjct: 1029 CLDPPLQTVPKGGWKCKWCVWCRHCGATS 1057
>MLL3_HUMAN (Q8NEZ4) Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog| (Histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3) (EC 2.1.1.43) (Homologous to ALR protein) Length = 4911 Score = 39.3 bits (90), Expect = 0.004 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -2 Query: 368 CEDPPWDSIPDRAYCCRWCSWCKVCSEDS 282 C DPP ++P + C+WC WC+ C S Sbjct: 1036 CLDPPLQTVPKGGWKCKWCVWCRHCGATS 1064
>AP1B1_HUMAN (Q10567) AP-1 complex subunit beta-1 (Adapter-related protein complex| 1 beta-1 subunit) (Beta-adaptin 1) (Adaptor protein complex AP-1 beta-1 subunit) (Golgi adaptor HA1/AP1 adaptin beta subunit) (Clathrin assembly protein complex 1 beta larg Length = 949 Score = 38.5 bits (88), Expect = 0.007 Identities = 24/72 (33%), Positives = 37/72 (51%), Gaps = 3/72 (4%) Frame = -3 Query: 436 LAASNVFFIAKRRNANMDVLYLSAKIPRGIPFLIELTAAVGAPGA---KCAVKTPNREFV 266 L +SN+F +AKR D+LY S K+ GI L EL G P + ++K E Sbjct: 877 LQSSNIFTVAKRNVEGQDMLYQSLKLTNGIWVLAELRIQPGNPSCTDLELSLKCRAPEVS 936 Query: 265 PLFFEAMESLIK 230 ++A E+++K Sbjct: 937 QHVYQAYETILK 948
>MT2_CALSI (P55950) Metallothionein-2B (MT-2B) (Metallothionein-IIB) (MT-IIB)| [Contains: Metallothionein-2A (MT-2A) (Metallothionein-IIA) (MT-IIA)] Length = 58 Score = 35.0 bits (79), Expect = 0.081 Identities = 17/49 (34%), Positives = 21/49 (42%) Frame = -2 Query: 434 CSIKCVLYCQEEKCKYGCAVSVCEDPPWDSIPDRAYCCRWCSWCKVCSE 288 C+ KC C+E +CK GC C PP D C K CS+ Sbjct: 6 CNDKCE--CKEGECKTGCKCKSCRCPPCDKCSSECKCTSKEECSKTCSK 52
>MT2_SCYSE (P02806) Metallothionein-2 (MT-2) (Metallothionein-II) (MT-II)| Length = 57 Score = 32.7 bits (73), Expect = 0.40 Identities = 16/49 (32%), Positives = 22/49 (44%) Frame = -2 Query: 434 CSIKCVLYCQEEKCKYGCAVSVCEDPPWDSIPDRAYCCRWCSWCKVCSE 288 C+ KC C+E +CK GC + C PP + C K CS+ Sbjct: 5 CNDKCD--CKEGECKTGCKCTSCRCPPCEQCSSGCKCANKEDCRKTCSK 51
>MT1_SCYSE (P02805) Metallothionein-1 (MT-1) (Metallothionein-I) (MT-I)| Length = 58 Score = 32.0 bits (71), Expect = 0.68 Identities = 16/49 (32%), Positives = 21/49 (42%) Frame = -2 Query: 434 CSIKCVLYCQEEKCKYGCAVSVCEDPPWDSIPDRAYCCRWCSWCKVCSE 288 C+ KCV C+E CK GC + C P + C K CS+ Sbjct: 5 CNDKCV--CKEGGCKEGCQCTSCRCSPCEKCSSGCKCANKEECSKTCSK 51
>MT1_CALSI (P55949) Metallothionein-1B (MT-1B) (Metallothionein-IB) (MT-IB)| [Contains: Metallothionein-1A (MT-1A) (Metallothionein-IA) (MT-IA)] Length = 59 Score = 31.2 bits (69), Expect = 1.2 Identities = 16/49 (32%), Positives = 20/49 (40%) Frame = -2 Query: 434 CSIKCVLYCQEEKCKYGCAVSVCEDPPWDSIPDRAYCCRWCSWCKVCSE 288 C+ KCV CQE CK GC + C P C K C++ Sbjct: 6 CNDKCV--CQEGGCKAGCQCTSCRCSPCQKCTSGCKCATKEECSKTCTK 52
>MLL2_HUMAN (O14686) Myeloid/lymphoid or mixed-lineage leukemia protein 2| (ALL1-related protein) Length = 5262 Score = 31.2 bits (69), Expect = 1.2 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = -2 Query: 368 CEDPPWDSIPDRAYCCRWCSWCKVCSEDS 282 C DPP ++P + C+WC C C S Sbjct: 1181 CLDPPLLTVPKGGWKCKWCVSCMQCGAAS 1209
>KRA54_HUMAN (Q6L8H1) Keratin-associated protein 5-4 (Keratin-associated protein| 5.4) (Ultrahigh sulfur keratin-associated protein 5.4) Length = 288 Score = 30.8 bits (68), Expect = 1.5 Identities = 19/54 (35%), Positives = 22/54 (40%) Frame = -2 Query: 434 CSIKCVLYCQEEKCKYGCAVSVCEDPPWDSIPDRAYCCRWCSWCKVCSEDSKQG 273 C C CQ CK C+ S C S + YCC+ S CK C S G Sbjct: 211 CGSSC---CQSSCCKPCCSSSGCGSSCCQSSCCKPYCCQ-SSCCKPCCSSSGCG 260
>MT_CARMA (P55948) Metallothionein (MT)| Length = 58 Score = 30.4 bits (67), Expect = 2.0 Identities = 15/49 (30%), Positives = 20/49 (40%) Frame = -2 Query: 434 CSIKCVLYCQEEKCKYGCAVSVCEDPPWDSIPDRAYCCRWCSWCKVCSE 288 C KC C+E CK GC + C P + C CK C++ Sbjct: 6 CIDKCE--CKEGGCKAGCKCTSCRCTPCEKCSSGCKCTTKEDCCKTCTK 52
>T2R38_PANPA (Q697L6) Taste receptor type 2 member 38 (T2R38)| Length = 333 Score = 30.4 bits (67), Expect = 2.0 Identities = 20/75 (26%), Positives = 32/75 (42%), Gaps = 14/75 (18%) Frame = -1 Query: 192 NYSVMSIQLCCFMEVSVN-----CIVLLLCY----FYFTVFKLLVSWF-----QNFLGIL 55 N+S +I + + N C+ LL C F T L SW Q LGI+ Sbjct: 89 NHSYQAINMLWMIANQANLWLAACLSLLYCSKLIRFSHTFLICLASWVSRKISQMLLGII 148 Query: 54 ILDILCRINCIFCLW 10 + +C + C++C + Sbjct: 149 LCSCICTVLCVWCFF 163
>T2R38_PONPY (Q697L3) Taste receptor type 2 member 38 (T2R38)| Length = 333 Score = 29.6 bits (65), Expect = 3.4 Identities = 16/52 (30%), Positives = 24/52 (46%), Gaps = 9/52 (17%) Frame = -1 Query: 138 CIVLLLCY----FYFTVFKLLVSWF-----QNFLGILILDILCRINCIFCLW 10 C+ LL C F T L SW Q LGI++ +C + C++C + Sbjct: 112 CLSLLYCSKLIRFSHTFLICLASWVSRKISQMLLGIILCSCICTVLCVWCFF 163
>T2R38_PAPHA (Q646E9) Taste receptor type 2 member 38 (T2R38)| Length = 333 Score = 29.6 bits (65), Expect = 3.4 Identities = 16/52 (30%), Positives = 24/52 (46%), Gaps = 9/52 (17%) Frame = -1 Query: 138 CIVLLLCY----FYFTVFKLLVSWF-----QNFLGILILDILCRINCIFCLW 10 C+ LL C F T L SW Q LGI++ +C + C++C + Sbjct: 112 CLSLLYCSKLIRFSHTFLICLASWVSRKISQMLLGIILCSCICTVLCVWCFF 163
>T2R38_PANTR (Q697L5) Taste receptor type 2 member 38 (T2R38)| Length = 333 Score = 29.6 bits (65), Expect = 3.4 Identities = 16/52 (30%), Positives = 24/52 (46%), Gaps = 9/52 (17%) Frame = -1 Query: 138 CIVLLLCY----FYFTVFKLLVSWF-----QNFLGILILDILCRINCIFCLW 10 C+ LL C F T L SW Q LGI++ +C + C++C + Sbjct: 112 CLSLLYCSKLIRFSHTFLICLASWVSRKISQMLLGIILCSCICTVLCVWCFF 163
>T2R38_HUMAN (P59533) Taste receptor type 2 member 38 (T2R38) (T2R61) (PTC| bitter taste receptor) Length = 333 Score = 29.6 bits (65), Expect = 3.4 Identities = 16/52 (30%), Positives = 24/52 (46%), Gaps = 9/52 (17%) Frame = -1 Query: 138 CIVLLLCY----FYFTVFKLLVSWF-----QNFLGILILDILCRINCIFCLW 10 C+ LL C F T L SW Q LGI++ +C + C++C + Sbjct: 112 CLSLLYCSKLIRFSHTFLICLASWVSRKISQMLLGIILCSCICTVLCVWCFF 163
>T2R38_GORGO (Q697L4) Taste receptor type 2 member 38 (T2R38)| Length = 333 Score = 29.6 bits (65), Expect = 3.4 Identities = 16/52 (30%), Positives = 24/52 (46%), Gaps = 9/52 (17%) Frame = -1 Query: 138 CIVLLLCY----FYFTVFKLLVSWF-----QNFLGILILDILCRINCIFCLW 10 C+ LL C F T L SW Q LGI++ +C + C++C + Sbjct: 112 CLSLLYCSKLIRFSHTFLICLASWVSRKISQMLLGIILCSCICTVLCVWCFF 163
>KR107_HUMAN (P60409) Keratin-associated protein 10-7 (Keratin-associated| protein 10.7) (High sulfur keratin-associated protein 10.7) (Keratin-associated protein 18-7) (Keratin-associated protein 18.7) Length = 370 Score = 29.6 bits (65), Expect = 3.4 Identities = 17/53 (32%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Frame = -2 Query: 437 SCSIKCVLYCQEEKCKYGC-AVSVCEDPPWDSIPDRAYCCRWCSWCKVCSEDS 282 SC+ C CQ+ C+ C A S C+ + + CC+ VCS DS Sbjct: 84 SCTPSC---CQQSSCQLACCASSPCQQACCVPVCCKTVCCKPVYCVPVCSGDS 133
>ZNHI2_HUMAN (Q9UHR6) Zinc finger HIT domain-containing protein 2 (Protein FON)| Length = 403 Score = 29.6 bits (65), Expect = 3.4 Identities = 16/40 (40%), Positives = 24/40 (60%), Gaps = 1/40 (2%) Frame = -3 Query: 268 VPLFFEAMESLIK*-VTGNLRMDIPSKLFSYEHTAVLFHG 152 VP A+ SL + V+ +R +P+ LF+Y HT L+HG Sbjct: 192 VPTRIPAIVSLSRGPVSPLVRFQLPNVLFAYAHTLALYHG 231
>ZNHI2_MOUSE (Q9QY66) Zinc finger HIT domain-containing protein 2 (Protein FON)| Length = 399 Score = 29.3 bits (64), Expect = 4.4 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -3 Query: 214 LRMDIPSKLFSYEHTAVLFHG 152 +R +P+ LF+Y HT L+HG Sbjct: 206 VRFQLPNVLFAYAHTLALYHG 226
>KRA58_HUMAN (O75690) Keratin-associated protein 5-8 (Keratin-associated protein| 5.8) (Ultrahigh sulfur keratin-associated protein 5.8) (Keratin, ultra high-sulfur matrix protein B) (UHS keratin B) (UHS KerB) Length = 187 Score = 28.5 bits (62), Expect = 7.6 Identities = 20/53 (37%), Positives = 23/53 (43%), Gaps = 1/53 (1%) Frame = -2 Query: 437 SCSIKC-VLYCQEEKCKYGCAVSVCEDPPWDSIPDRAYCCRWCSWCKVCSEDS 282 SCS C CQ CK C+ S C P S + CC+ S CK C S Sbjct: 124 SCSSGCGSSCCQSSCCKPCCSQSSCCKPCCCSSGCGSSCCQ-SSCCKPCCSQS 175
>POU1_BRARE (P31366) POU domain protein 1 (ZFPOU1)| Length = 425 Score = 28.5 bits (62), Expect = 7.6 Identities = 20/57 (35%), Positives = 24/57 (42%) Frame = +1 Query: 208 SLSYPSLT**ETP*LQRIEARTPCLESSLHTLHQEHQRQQ*ALSGMESHGGSSQTDT 378 SL +P L +TP L S H H +HQ Q A G+ SH S DT Sbjct: 192 SLVHPGLVRGDTPELDH--------SSHHHHHHHQHQHHQQAHHGVNSHDPHSDEDT 240
>KR106_HUMAN (P60371) Keratin-associated protein 10-6 (Keratin-associated| protein 10.6) (High sulfur keratin-associated protein 10.6) (Keratin-associated protein 18-6) (Keratin-associated protein 18.6) Length = 365 Score = 28.5 bits (62), Expect = 7.6 Identities = 16/53 (30%), Positives = 23/53 (43%), Gaps = 1/53 (1%) Frame = -2 Query: 437 SCSIKCVLYCQEEKCKYGC-AVSVCEDPPWDSIPDRAYCCRWCSWCKVCSEDS 282 SC+ C CQ+ C+ C A S C+ + + CC+ VC DS Sbjct: 84 SCTPSC---CQQSSCQLACCASSPCQQACCVPVCCKTVCCKPVCCVSVCCGDS 133
>UHRF2_HUMAN (Q96PU4) Ubiquitin-like PHD and RING finger domain-containing| protein 2 (EC 6.3.2.-) (Ubiquitin-like-containing PHD and RING finger domains protein 2) (Np95/ICBP90-like RING finger protein) (Np95-like RING finger protein) (Nuclear zinc finger Length = 802 Score = 28.5 bits (62), Expect = 7.6 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = -2 Query: 368 CEDPPWDSIPDRAYCCRWCSWCKVCSEDSKQGVRA 264 C +PP D +P+ Y W +C C DS + V+A Sbjct: 373 CLNPPLDKVPEEEY---W--YCPSCKTDSSEVVKA 402
>TRGS_TACTR (P81281) 8.6 kDa transglutaminase substrate| Length = 81 Score = 28.5 bits (62), Expect = 7.6 Identities = 11/35 (31%), Positives = 15/35 (42%) Frame = -2 Query: 395 CKYGCAVSVCEDPPWDSIPDRAYCCRWCSWCKVCS 291 C GC S C D + A C+ C +C C+ Sbjct: 6 CSVGCDTSYCPDTSSCNCGTFADYCKCCQYCNACA 40
>MT_POTPO (P55952) Metallothionein (MT)| Length = 58 Score = 28.5 bits (62), Expect = 7.6 Identities = 11/37 (29%), Positives = 15/37 (40%) Frame = -2 Query: 434 CSIKCVLYCQEEKCKYGCAVSVCEDPPWDSIPDRAYC 324 C + C+E KCK GC + C P + C Sbjct: 4 CCAEGTCECEEGKCKAGCKCTSCRCSPCEKCTSECEC 40
>MT1_HOMAM (P29499) Metallothionein-1 (CuMT-1)| Length = 58 Score = 28.5 bits (62), Expect = 7.6 Identities = 18/54 (33%), Positives = 22/54 (40%), Gaps = 6/54 (11%) Frame = -2 Query: 434 CSIKCVLYCQEEKCKYGCAVSVCEDPPWD------SIPDRAYCCRWCSWCKVCS 291 C KC C E CK GC + C P + P + C + CS K CS Sbjct: 5 CKDKCE--CAEGGCKTGCKCTSCRCAPCEKCTSGCKCPSKDECAKTCS--KPCS 54
>KR104_HUMAN (P60372) Keratin-associated protein 10-4 (Keratin-associated| protein 10.4) (High sulfur keratin-associated protein 10.4) (Keratin-associated protein 18-4) (Keratin-associated protein 18.4) Length = 401 Score = 28.5 bits (62), Expect = 7.6 Identities = 17/53 (32%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Frame = -2 Query: 437 SCSIKCVLYCQEEKCKYGCAVSV-CEDPPWDSIPDRAYCCRWCSWCKVCSEDS 282 SC+ C CQ+ C+ C S C+ + + CC+ VCSEDS Sbjct: 203 SCTPSC---CQQSSCQPACCTSSSCQQACCVPVCCKTVCCK-----PVCSEDS 247 Score = 28.1 bits (61), Expect = 9.9 Identities = 21/65 (32%), Positives = 26/65 (40%), Gaps = 10/65 (15%) Frame = -2 Query: 437 SCSIKCVLYCQEEKCKYGCAVSVCEDP----PWDSIP----DRAYCCRWCSWCKVC--SE 288 SC C C C+ C V VC P P S+P + CC+ S C S Sbjct: 255 SCQPAC---CTSSPCQQACCVPVCCKPVCCKPVGSVPICSGASSLCCQQSSCQPACCTSS 311 Query: 287 DSKQG 273 S+QG Sbjct: 312 QSQQG 316 Score = 28.1 bits (61), Expect = 9.9 Identities = 16/53 (30%), Positives = 23/53 (43%), Gaps = 1/53 (1%) Frame = -2 Query: 437 SCSIKCVLYCQEEKCKYGC-AVSVCEDPPWDSIPDRAYCCRWCSWCKVCSEDS 282 SC+ C CQ+ C+ C A S C+ + + CC+ VC DS Sbjct: 84 SCTPSC---CQQSSCQLACCASSPCQQACCVPVCCKTVCCKPVCCVPVCCGDS 133
>POU23_BRARE (P79745) POU domain protein ZP-23| Length = 443 Score = 28.5 bits (62), Expect = 7.6 Identities = 20/57 (35%), Positives = 24/57 (42%) Frame = +1 Query: 208 SLSYPSLT**ETP*LQRIEARTPCLESSLHTLHQEHQRQQ*ALSGMESHGGSSQTDT 378 SL +P L +TP L S H H +HQ Q A G+ SH S DT Sbjct: 192 SLVHPGLVRGDTPELDH--------SSHHHHHHHQHQHHQQAHHGVNSHDPHSDEDT 240
>ANTA_HAEGH (P16242) Ghilanten| Length = 119 Score = 28.1 bits (61), Expect = 9.9 Identities = 11/37 (29%), Positives = 19/37 (51%), Gaps = 2/37 (5%) Frame = -2 Query: 428 IKCVLYCQE--EKCKYGCAVSVCEDPPWDSIPDRAYC 324 ++C +YC ++ +YGC V C P + D + C Sbjct: 31 VRCRVYCSHGFQRSRYGCEVCRCRTEPMKATCDISEC 67
>UHRF2_MOUSE (Q7TMI3) Ubiquitin-like PHD and RING finger domain-containing| protein 2 (EC 6.3.2.-) (Ubiquitin-like-containing PHD and RING finger domains protein 2) (Np95-like ring finger protein) (Nuclear zinc finger protein Np97) (NIRF) Length = 803 Score = 28.1 bits (61), Expect = 9.9 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = -2 Query: 368 CEDPPWDSIPDRAYCCRWCSWCKVCSEDSKQGVRA 264 C PP D +P+ Y W +C C DS + V+A Sbjct: 374 CLSPPLDKVPEEEY---W--YCPSCKTDSSEVVKA 403
>CSTF2_MOUSE (Q8BIQ5) Cleavage stimulation factor, 64 kDa subunit (CSTF 64 kDa| subunit) (CF-1 64 kDa subunit) (CstF-64) Length = 580 Score = 28.1 bits (61), Expect = 9.9 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = -3 Query: 373 LSAKIPRGIPFLIELTAAVGAPG 305 + A +P G+P +++ AAVG PG Sbjct: 246 MQASMPGGVPAPVQMAAAVGGPG 268
>MPAA5_AMBEL (P02878) Pollen allergen Amb a 5 (Amb a V) (Allergen Ra5)| Length = 45 Score = 28.1 bits (61), Expect = 9.9 Identities = 12/23 (52%), Positives = 14/23 (60%), Gaps = 4/23 (17%) Frame = -2 Query: 335 RAYCC----RWCSWCKVCSEDSK 279 RAYCC R+C W VC E S+ Sbjct: 15 RAYCCSDPGRYCPWQVVCYESSE 37
>MPA5A_AMBPS (P43174) Pollen allergen Amb p 5a precursor (Amb p Va)| Length = 77 Score = 28.1 bits (61), Expect = 9.9 Identities = 12/23 (52%), Positives = 14/23 (60%), Gaps = 4/23 (17%) Frame = -2 Query: 335 RAYCC----RWCSWCKVCSEDSK 279 RAYCC R+C W VC E S+ Sbjct: 37 RAYCCSDPGRYCPWQVVCYESSE 59
>TRAF1_HUMAN (Q13077) TNF receptor-associated factor 1 (Epstein-Barr| virus-induced protein 6) Length = 416 Score = 28.1 bits (61), Expect = 9.9 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = -2 Query: 404 EEKCKYGCAVSVCEDPPWDSIPDRAYCCRWC 312 E + +GC +VC+DP RA CC C Sbjct: 15 ENEFPFGCPPTVCQDPK----EPRALCCAGC 41
>YFC3_SCHPO (O14138) Hypothetical protein C25A8.03c in chromosome I| Length = 467 Score = 28.1 bits (61), Expect = 9.9 Identities = 18/44 (40%), Positives = 22/44 (50%) Frame = -1 Query: 171 QLCCFMEVSVNCIVLLLCYFYFTVFKLLVSWFQNFLGILILDIL 40 Q F E N +VL YF VF L + F + GI+ LDIL Sbjct: 126 QRSLFSESISNYLVLQYKLRYFPVFDLKIYDFHSGTGIIALDIL 169 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 63,771,950 Number of Sequences: 219361 Number of extensions: 1255767 Number of successful extensions: 3787 Number of sequences better than 10.0: 40 Number of HSP's better than 10.0 without gapping: 3621 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3777 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2570413340 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)