Clone Name | rbastl22b04 |
---|---|
Clone Library Name | barley_pub |
>EX7L_XANAC (Q8PJW7) Probable exodeoxyribonuclease VII large subunit (EC| 3.1.11.6) (Exonuclease VII large subunit) Length = 445 Score = 30.4 bits (67), Expect = 1.2 Identities = 18/60 (30%), Positives = 28/60 (46%) Frame = +2 Query: 11 HILGLKWRRITRSATKL*THNPKQQTDRWAQIFILLHLQSTGGLKQQHEQRQVEGITDRL 190 H+L R+ R +L +HNP++ Q LH Q+ + QH+Q Q+ I L Sbjct: 331 HVLERLQARVQRGQAQLQSHNPQRHLAGLQQRLRALHPQAAMQRRLQHDQLQLRRIARSL 390
>KR510_HUMAN (Q6L8G5) Keratin-associated protein 5-10 (Keratin-associated| protein 5.10) (Ultrahigh sulfur keratin-associated protein 5.10) Length = 202 Score = 30.0 bits (66), Expect = 1.5 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = -2 Query: 174 PSTCRCSCCCFRPPVLCRCSRIKICAHLSVCC 79 P C+ SCC PV C+ S K C S CC Sbjct: 165 PCCCQSSCCV---PVCCQSSCCKPCCCQSSCC 193
>KRA92_HUMAN (Q9BYQ4) Keratin-associated protein 9-2 (Keratin-associated protein| 9.2) (Ultrahigh sulfur keratin-associated protein 9.2) Length = 174 Score = 29.6 bits (65), Expect = 2.0 Identities = 13/38 (34%), Positives = 19/38 (50%), Gaps = 6/38 (15%) Frame = -2 Query: 174 PSTCRCSCC---CFRPPVLCRCSRIKIC---AHLSVCC 79 P+ CR +CC C++P + CS C +S CC Sbjct: 11 PTCCRTTCCRTTCWKPTTVTTCSSTSCCQPACCVSSCC 48
>KRA52_HUMAN (Q701N4) Keratin-associated protein 5-2 (Keratin-associated protein| 5.2) (Ultrahigh sulfur keratin-associated protein 5.2) (Keratin-associated protein 5-8) (Keratin-associated protein 5.8) Length = 177 Score = 29.6 bits (65), Expect = 2.0 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = -2 Query: 174 PSTCRCSCCCFRPPVLCRCSRIKICAHLSVCC 79 P C+ SCC PV C+ S K C S CC Sbjct: 140 PCCCQSSCCV---PVCCQSSCCKPCCCQSNCC 168
>KRA99_HUMAN (Q9BYP9) Keratin-associated protein 9-9 (Keratin-associated protein| 9.9) (Ultrahigh sulfur keratin-associated protein 9.9) Length = 154 Score = 29.3 bits (64), Expect = 2.6 Identities = 13/38 (34%), Positives = 19/38 (50%), Gaps = 6/38 (15%) Frame = -2 Query: 174 PSTCRCSCC---CFRPPVLCRCSRIKIC---AHLSVCC 79 P+ CR +CC C++P + CS C +S CC Sbjct: 11 PTCCRTTCCRTTCWKPTTVTTCSSTPCCQPSCCVSSCC 48
>KRA94_HUMAN (Q9BYQ2) Keratin-associated protein 9-4 (Keratin-associated protein| 9.4) (Ultrahigh sulfur keratin-associated protein 9.4) Length = 154 Score = 29.3 bits (64), Expect = 2.6 Identities = 13/38 (34%), Positives = 19/38 (50%), Gaps = 6/38 (15%) Frame = -2 Query: 174 PSTCRCSCC---CFRPPVLCRCSRIKIC---AHLSVCC 79 P+ CR +CC C++P + CS C +S CC Sbjct: 11 PTCCRTTCCRTTCWKPTTVTTCSSTPCCQPSCCVSSCC 48
>CECR6_HUMAN (Q9BXQ6) Cat eye syndrome critical region protein 6| Length = 578 Score = 28.9 bits (63), Expect = 3.4 Identities = 16/43 (37%), Positives = 19/43 (44%) Frame = -2 Query: 171 STCRCSCCCFRPPVLCRCSRIKICAHLSVCCFGLWVYNFVALL 43 S C C CCC P R R + CA C +G + V LL Sbjct: 167 SCCPCCCCCGCPDRPGRRGRRRGCAPSPRCRWGYQALSVVLLL 209
>MT4_MOUSE (P47945) Metallothionein-4 (MT-4) (Metallothionein-IV) (MT-IV)| Length = 62 Score = 28.9 bits (63), Expect = 3.4 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -2 Query: 168 TCRCSCCCFRPPVLCRCSRIKIC 100 TCR SCC PP +C+R IC Sbjct: 29 TCRKSCCPCCPPGCAKCARGCIC 51
>MT4_HUMAN (P47944) Metallothionein-4 (MT-4) (Metallothionein-IV) (MT-IV)| Length = 62 Score = 28.9 bits (63), Expect = 3.4 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -2 Query: 168 TCRCSCCCFRPPVLCRCSRIKIC 100 TCR SCC PP +C+R IC Sbjct: 29 TCRKSCCPCCPPGCAKCARGCIC 51
>HSP90_EIMTE (O44001) Heat shock protein 90| Length = 713 Score = 28.5 bits (62), Expect = 4.5 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = +3 Query: 72 IQSNRQTDGHKSLFCCTYKALEV*NSSMNNDKSKELQTD 188 +Q ++ D HK L CCT + LE+ S K +EL+ + Sbjct: 514 VQQLKEFDNHK-LRCCTKEGLEIDESEEEKKKFEELKAE 551
>KRA47_HUMAN (Q9BYR0) Keratin-associated protein 4-7 (Keratin-associated protein| 4.7) (Ultrahigh sulfur keratin-associated protein 4.7) Length = 210 Score = 28.5 bits (62), Expect = 4.5 Identities = 16/36 (44%), Positives = 19/36 (52%), Gaps = 4/36 (11%) Frame = -2 Query: 174 PSTCRCSCC---CFRPPV-LCRCSRIKICAHLSVCC 79 P+ C SCC C RP + RC R + C SVCC Sbjct: 107 PTCCHPSCCISSCCRPSCCVSRCCRPQCCQ--SVCC 140
>KR415_HUMAN (Q9BYQ5) Keratin-associated protein 4-15 (Keratin-associated| protein 4.15) (Ultrahigh sulfur keratin-associated protein 4.15) (Fragment) Length = 193 Score = 28.1 bits (61), Expect = 5.8 Identities = 15/36 (41%), Positives = 18/36 (50%), Gaps = 4/36 (11%) Frame = -2 Query: 174 PSTCRCSC----CCFRPPVLCRCSRIKICAHLSVCC 79 P+ CR SC CC + RC R + C SVCC Sbjct: 90 PTCCRPSCSISSCCRPSCCVSRCCRSQCCQ--SVCC 123
>ZNFX1_HUMAN (Q9P2E3) NFX1-type zinc finger-containing protein 1| Length = 1918 Score = 27.7 bits (60), Expect = 7.6 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = -2 Query: 159 CSCCCFRPPVLCRCSRIKICAHLSVCCFGL 70 CS C RPP C+++ +C H C GL Sbjct: 1527 CSEPCNRPPCYVPCTKLLVCGH---PCIGL 1553
>V002_FOWPV (Q9ICF9) Hypothetical protein FPV002/FPV259| Length = 222 Score = 27.7 bits (60), Expect = 7.6 Identities = 13/37 (35%), Positives = 18/37 (48%), Gaps = 1/37 (2%) Frame = -2 Query: 183 SVIPSTCRCSCCCFRP-PVLCRCSRIKICAHLSVCCF 76 SV P+TC+C C P V C C + + CC+ Sbjct: 24 SVRPATCKCVHCLLYPFEVCCECMSETLDSLEHSCCY 60
>MT4_CANFA (Q9TUI5) Metallothionein-4 (MT-4) (Metallothionein-IV) (MT-IV)| Length = 62 Score = 27.3 bits (59), Expect = 9.9 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -2 Query: 168 TCRCSCCCFRPPVLCRCSRIKIC 100 TCR SCC PP +C++ IC Sbjct: 29 TCRKSCCPCCPPGCAKCAQGCIC 51
>CECR6_MOUSE (Q99MX7) Cat eye syndrome critical region protein 6 homolog| Length = 572 Score = 27.3 bits (59), Expect = 9.9 Identities = 16/44 (36%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Frame = -2 Query: 171 STCRCSCCCF-RPPVLCRCSRIKICAHLSVCCFGLWVYNFVALL 43 S C C CCC RP R R + C+ C +G + V LL Sbjct: 162 SCCSCCCCCCGRPTRSGRRGRRRGCSPSPGCRWGYQALSVVLLL 205 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 46,638,313 Number of Sequences: 219361 Number of extensions: 840557 Number of successful extensions: 2291 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 2191 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2281 length of database: 80,573,946 effective HSP length: 80 effective length of database: 63,025,066 effective search space used: 1512601584 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)