Clone Name | rbastl22b03 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | GAT1B_XENLA (P23768) GATA-binding factor 1-B (Transcription fact... | 32 | 0.50 | 2 | GAT1A_XENLA (P23767) GATA-binding factor 1-A (Transcription fact... | 31 | 0.65 | 3 | PRA12_HUMAN (O95522) PRAME family member DJ1198H6.2 | 30 | 1.5 |
---|
>GAT1B_XENLA (P23768) GATA-binding factor 1-B (Transcription factor xGATA-1B)| Length = 364 Score = 31.6 bits (70), Expect = 0.50 Identities = 11/20 (55%), Positives = 16/20 (80%) Frame = +2 Query: 230 NHFTRNPRLSHSAPVLSYYY 289 +HF ++PR+SHS P +SY Y Sbjct: 334 HHFLQSPRMSHSTPAVSYRY 353
>GAT1A_XENLA (P23767) GATA-binding factor 1-A (Transcription factor xGATA-1A)| Length = 359 Score = 31.2 bits (69), Expect = 0.65 Identities = 11/18 (61%), Positives = 16/18 (88%) Frame = +2 Query: 230 NHFTRNPRLSHSAPVLSY 283 +HF ++PR+SHSAP +SY Sbjct: 332 HHFLQSPRISHSAPAVSY 349
>PRA12_HUMAN (O95522) PRAME family member DJ1198H6.2| Length = 483 Score = 30.0 bits (66), Expect = 1.5 Identities = 17/52 (32%), Positives = 23/52 (44%), Gaps = 1/52 (1%) Frame = +1 Query: 163 GRAVQLSS*IMKTKRCFRMPEIEPFHAKPAPQ-XXXXXXXXXXXHCIAGSIC 315 GR QL + +MKT R R P+I F P P+ HC+ + C Sbjct: 427 GRFSQLGAELMKTLRDLRQPKIIVFSTVPCPRCGIRASYDLEPSHCLLNACC 478 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,951,376 Number of Sequences: 219361 Number of extensions: 679871 Number of successful extensions: 1320 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1298 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1320 length of database: 80,573,946 effective HSP length: 94 effective length of database: 59,954,012 effective search space used: 1438896288 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)