Clone Name | rbastl21h12 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | GIMA2_HUMAN (Q9UG22) GTPase, IMAP family member 2 (Immunity-asso... | 28 | 6.7 | 2 | AFP_ASPGI (P17737) Antifungal protein precursor | 28 | 8.7 | 3 | ESM1_RAT (P97682) Endothelial cell-specific molecule 1 precursor... | 28 | 8.7 | 4 | ESM1_MOUSE (Q9QYY7) Endothelial cell-specific molecule 1 precurs... | 28 | 8.7 |
---|
>GIMA2_HUMAN (Q9UG22) GTPase, IMAP family member 2 (Immunity-associated protein| 2) (hIMAP2) Length = 337 Score = 28.1 bits (61), Expect = 6.7 Identities = 11/41 (26%), Positives = 24/41 (58%) Frame = -1 Query: 126 LHIVLQWSCLYNLPCPLHCITIYTLTLVYTCGLNILI*KKV 4 L +++ W C+ + C L C ++++ ++ C L +I KK+ Sbjct: 281 LRLIILWLCILHSMCNLFCCLLFSMCNLF-CSLLFIIPKKL 320
>AFP_ASPGI (P17737) Antifungal protein precursor| Length = 94 Score = 27.7 bits (60), Expect = 8.7 Identities = 14/53 (26%), Positives = 24/53 (45%) Frame = +2 Query: 26 FNPQVYTRVNV*IVIQCKGQGRLYKQLHCNTMCKLCTRNQQTKKFNQYKSNCW 184 +N + Y + N+ CK + + K C K C R+ +F+ YK C+ Sbjct: 46 YNGKCYKKDNI-----CKYKAQSGKTAICKCYVKKCPRDGAKCEFDSYKGKCY 93
>ESM1_RAT (P97682) Endothelial cell-specific molecule 1 precursor (ESM-1| secretory protein) (ESM-1) (PG25) Length = 184 Score = 27.7 bits (60), Expect = 8.7 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -1 Query: 126 LHIVLQWSCLYNLPCPLHC 70 LH+ + WS Y + CP HC Sbjct: 14 LHLGMAWSAKYAVDCPEHC 32
>ESM1_MOUSE (Q9QYY7) Endothelial cell-specific molecule 1 precursor (ESM-1| secretory protein) (ESM-1) Length = 184 Score = 27.7 bits (60), Expect = 8.7 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -1 Query: 126 LHIVLQWSCLYNLPCPLHC 70 LH+ + WS Y + CP HC Sbjct: 14 LHLGMAWSAKYAVDCPEHC 32 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 26,340,446 Number of Sequences: 219361 Number of extensions: 422609 Number of successful extensions: 890 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 884 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 890 length of database: 80,573,946 effective HSP length: 37 effective length of database: 72,457,589 effective search space used: 1738982136 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)